KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_0674Help
Entry
ECSE_0674         CDS       T00784                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Brite
KEGG Orthology (KO) [BR:ecy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ECSE_0674
Enzymes [BR:ecy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ECSE_0674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 Thi4 NAD_binding_8 K_oxygenase AlaDh_PNT_C Glutaredoxin DAO FMO-like NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: BAG76198
UniProt: B6I0R5
LinkDB All DBs
Structure
PDB: 

Position
724612..726207
Genome map
AA seq 531 aa AA seqDB search
MMMFKAQEINMLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKV
TFKEDNSLPVRKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLE
QIRHIDGDFEFETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMG
VPAVFVNGKEFGQGRMTLTEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAIY
SARKGIRTGLMGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYDVDVIDSQSA
SKLIPAAVEGGLHQIETASGAVLKARSIIVATGAKWRNMNVPGEDQYRTKGVTYCPHCDG
PLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKNVDIIL
NAQTTEVKGDGSKVVGLEYRDRVSGDIHNIELAGIFVQIGLLPNTNWLEGAVERNRMGEI
IIDAKCETNVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgtttaaagcccaggagataaacatgctcgacacaaatatgaaaactcaactc
aaggcttaccttgagaaattgaccaagcctgttgagttaattgccacgctggatgacagc
gctaaatcggcagaaatcaaggaactgttggctgaaatcgcagaactgtcagacaaagtc
acctttaaagaagataacagcttgccggtgcgtaagccgtctttcctgatcaccaaccca
ggttccaaccaggggccacgttttgcaggctccccgctgggccacgagttcacctcgctg
gtactggcgttgctgtggaccggtggtcatccgtcgaaagaagcgcagtctctgctggag
cagattcgccatattgacggtgattttgaattcgaaacctattactcgctctcttgccac
aactgcccggacgtggtgcaggcgctgaacctgatgagcgtactgaacccgcgcatcaag
cacactgcaattgacggcggcaccttccagaacgaaatcaccgatcgcaacgtgatgggc
gttccggcagtgttcgtaaacgggaaagagtttggtcagggccgcatgacgttgactgaa
atcgttgccaaaattgatactggcgcggaaaaacgtgcggcagaagagctgaacaagcgt
gatgcttatgacgtattaatcgtcggttccggcccggcgggtgcagcggcagcaatttac
tccgcacgtaaaggcatccgtaccggtctgatgggcgaacgttttggtggtcagatcctc
gataccgttgatatcgaaaactacatttctgtaccgaagactgaagggcagaagctggca
ggcgcactgaaagttcacgttgatgaatacgacgttgatgtgatcgacagccagagcgcc
agcaaactgatcccggcagcggttgaaggtggtctacaccagattgaaacagcttctggc
gcggtactgaaagcacgcagcattatcgtggcgaccggtgcaaaatggcgcaacatgaac
gttccgggcgaagatcagtatcgcaccaaaggcgtgacctactgcccgcactgcgacggc
ccgctgtttaaaggcaaacgcgtagcggttatcggcggcggtaactccggcgtggaagcg
gcaatcgacctggcgggtatcgttgagcacgtaacgctgctcgaatttgcgccagaaatg
aaagccgaccaggtgctgcaggacaaactgcgcagcctgaaaaacgtcgacattattctg
aatgcgcaaaccacggaagtgaaaggcgacggcagcaaagtcgttggtctggaatatcga
gatcgtgtcagcggcgatattcacaacatcgaactggccggtattttcgtccagattggt
ctgctgccgaacaccaactggctggaaggcgcagtcgaacgtaaccgcatgggtgagatt
atcattgatgcgaaatgcgaaaccaacgtcaaaggcgtattcgcagcgggtgactgtacg
acggttccgtacaagcagatcatcatcgccactggcgaaggtgccaaagcctctctgagt
gcttttgactacctgattcgcaccaaaactgcataa

DBGET integrated database retrieval system