KEGG   Escherichia coli DH1: EcDH1_3797Help
Entry
EcDH1_3797        CDS       T01996                                 

Definition
(GenBank) 3-dehydro-L-gulonate-6-phosphate decarboxylase
  KO
K03078  3-dehydro-L-gulonate-6-phosphate decarboxylase [EC:4.1.1.85]
Organism
edh  Escherichia coli DH1
Pathway
edh00040  Pentose and glucuronate interconversions
edh00053  Ascorbate and aldarate metabolism
edh01100  Metabolic pathways
edh01120  Microbial metabolism in diverse environments
Module
edh_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:edh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EcDH1_3797
   00053 Ascorbate and aldarate metabolism
    EcDH1_3797
Enzymes [BR:edh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.85  3-dehydro-L-gulonate-6-phosphate decarboxylase
     EcDH1_3797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase
Motif
Other DBs
NCBI-ProteinID: ACX41399
LinkDB All DBs
Structure
PDB: 

Position
complement(4091745..4092395)
Genome map
AA seq 216 aa AA seqDB search
MSLPMLQVALDNQTMDSAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVL
ADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIELTGYWTWE
QAQQWRDAGIGQVVYHRSRDAQAAGVAWGEADITAIKRLSDMGFKVTVTGGLALEDLPLF
KGIPIHVFIAGRSIRDAASPVEAARQFKRSIAELWG
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaccgatgttgcaagtcgcgctggacaaccagactatggatagcgcctacgaa
accactcgcctgattgccgaagaagtcgacattatcgaagtgggcaccattctgtgcgtg
ggcgaaggcgtgcgtgcggttcgtgacctgaaagcgctctacccgcacaaaatcgtactg
gcagacgccaaaattgccgatgcaggcaaaatcctttcgcgtatgtgcttcgaagccaac
gctgactgggtgacggtaatttgctgtgcggatatcaacaccgccaaaggcgcgctggac
gtggcaaaagagtttaacggcgacgtgcagatcgaactgaccggttactggacctgggaa
caggcgcaacagtggcgcgatgcaggcattgggcaggtggtttatcaccgcagccgtgac
gcgcaggccgcaggcgtggcgtggggcgaagcggacatcaccgcgatcaaacgtctttcc
gatatgggcttcaaagtcaccgtcaccggaggcctggcgctggaagatctgccgctgttc
aagggtattccgattcacgtctttatcgcgggccgtagtatccgtgatgccgcttctccg
gtggaagccgcacgtcagttcaaacgttccatcgctgaactgtggggctaa

DBGET integrated database retrieval system