KEGG   Enterococcus durans: LIU_08450Help
Entry
LIU_08450         CDS       T04048                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
edu  Enterococcus durans
Brite
KEGG Orthology (KO) [BR:edu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LIU_08450
Enzymes [BR:edu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     LIU_08450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA FAD_oxidored Thioredoxin_3 HI0933_like AlaDh_PNT_C Thi4 NAD_binding_9 NAD_binding_8 FMO-like K_oxygenase Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AKZ48418
LinkDB All DBs
Position
1795442..1796971
Genome map
AA seq 509 aa AA seqDB search
MLDKETKQNLAHYLEMLESPVIFSTSTDDSNDSRKLLEFLNEIAQMTEKVTIEEKKLSRT
PSFEINPLNGTSGIAFAGIPLGHEFSSFLLALLQVSGRPPKITDSLTQQIKQIQQDLYFE
TYVSLTCHNCPDVVQALNILSVLNPTIHHTMIEGGMYQNEITEKQVLAVPTVYLNGQEFA
SGRMTLEQIIEQITGPQTVTPSSESTPYDVLVIGGGPAASSAAIYAARKGIRTGLVADSL
GGQVIETLGIENMIGTPYTEGPQLMKQVEEHLRSYPVDIMTNQLVTSLQKQNDSFAVSLK
SGRKLTTKTAIIATGARWRSINVPGEKEFKNKGIAYCPHCDGPLFTGKDVAVIGGGNSGI
EAAINLAGLANHVYVLEFLSELKADKILQDKLATLSNVTILLNAETQEITGTTYVDSITY
KDRTTGENQTLDVAGVFILIGLVPNTEWLSALLEMNERGEIIVDLHGETSIKGLFAAGDC
TNSSYKQIIISMGSGATAALGAFDYLMRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgttagataaagaaacgaagcagaatctcgcccactatttagagatgttggaatctccc
gttattttttcaacaagtacagatgactctaatgattcaagaaagttacttgagttctta
aatgagattgcccagatgacggaaaaagtgacaatcgaagagaaaaagttgtctcgcaca
ccaagtttcgagatcaacccattaaatggaactagcgggatcgcctttgctgggattcct
ttaggtcacgagttttcatcttttttgcttgccctactacaggtcagtggtcgtcctcca
aaaatcacggattctttaacgcagcaaatcaagcaaattcagcaggacttatattttgaa
acctatgtcagcttgacttgtcataattgtccagatgtcgtacaggcattaaatattcta
tctgttttgaacccgacgatccatcatacgatgatcgagggcggcatgtaccagaatgaa
atcactgaaaaacaagtgttagcagtacctactgtctacttaaatgggcaagaatttgca
agtggacgtatgacacttgaacaaatcattgaacagattacaggtcctcaaacagttacg
ccatctagtgagtcaacgccttatgacgttttagttatcggtggtggtccagcagcgagc
agtgcagccatctacgcggcacgaaaaggcattcgtactggtcttgtagctgattctctt
ggtggccaagtgatcgaaacgttgggtattgaaaatatgatcgggacgccttatacagag
ggtccgcaattgatgaaacaagttgaagaacatttgcgttcttatccggtggacattatg
accaatcagttagtgacctcacttcaaaaacaaaacgattcttttgctgtttccttgaaa
agtggtcgaaaattaacaacaaaaactgctattatagcaactggcgcacgttggcgatca
atcaacgtacctggagaaaaggaatttaagaacaaaggtatcgcctattgtcctcactgt
gacgggccattgttcactgggaaggatgttgcggtgattggtggcggaaattccgggatt
gaagctgccattaatctggcaggactagcaaaccatgtttacgtattggaatttctttct
gaactaaaagcagacaaaatcttgcaagataaattagctacactttcaaatgtgaccatt
ttattaaatgcagaaacacaagaaatcacaggaactacttatgtcgactcaatcacttac
aaagaccgaactactggggaaaatcaaacattggatgttgctggtgtctttattttgatt
ggattggttccaaatacagaatggctttcagcccttcttgagatgaacgagcgtggagaa
atcattgttgatctgcatggagaaacatcgattaaaggattatttgctgctggcgactgt
acaaatagttcctataagcaaatcattatttcaatgggctccggtgcaactgcggctctc
ggagcatttgattatttgatgaggaattaa

DBGET integrated database retrieval system