KEGG   Electrophorus electricus (electric eel): 113589971
Entry
113589971         CDS       T05787                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04068  FoxO signaling pathway
eee04217  Necroptosis
eee04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    113589971 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113589971 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    113589971 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eee03000]
    113589971 (stat3)
Transcription factors [BR:eee03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    113589971 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int Spectrin
Other DBs
NCBI-GeneID: 113589971
NCBI-ProteinID: XP_026885665
LinkDB
Position
Unknown
AA seq 536 aa
MAQWNQLQQLETRYVEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMEIARIVARCLWEEQRLLQTAT
TAQQDGQAAHPSGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
AGELSQDLNGNSQAAATRQKMAQLEQMLSALDQLRRQIVTEMAGLLQAMDFVQKNLTDEE
LADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPIV
QHRPALEEKIVDLFRSLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTNKVRLLVKFPELN
YQLKIKVCIDKESSDVAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRTNTDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLVE
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggcccagtggaaccagttacaacagctggagacacgctacgtggagcagctgtaccac
ctgtacagtgacagcttccccatggagctccgccagtttctggcaccctggattgagagc
caagactgggcgtacgcagctaacaaggagtcccacgccacgctggtattccataacctg
ctgggggagatcgaccagcagtacagccgcttcctgcaggagaacaacgtcttgtaccag
cacaacctgcgacgcatcaaacagcacctgcagagtaaatacctggagaaacccatggag
atcgcacgcatcgtggcccgctgtttgtgggaggaacagagactgctgcagacagccact
actgcacagcaggacggccaagccgcccaccccagtggaactgtagtgaccgagaaacaa
cagatcctggaacacaacctacaggacatcaggaagagagtgcaggacatggagcagaag
atgaagatgctggagaacctgcaagacgactttgacttcaactacaagaccctgaagagc
gctggagaactctcacaggacctgaatggaaacagccaggccgcagccacacgtcagaag
atggcacagctggagcagatgctgagtgccctggaccagctccgcaggcaaatcgtgacg
gagatggccggactgctgcaggcgatggattttgtgcagaagaacctgacggacgaggag
ctggcagactggaagaggaggcagcagattgcctgtatcggaggaccaccaaacatctgt
ctggaccggctggagacgtggatcacctctctggctgagtctcagctgcagatcagacag
cagattaagaagttggaggagctgcagcagaaggtctcatacaaaggagaccccatagtc
cagcaccgccctgctctggaggagaagattgtagacctgttccgcagcctcatgaaaagt
gcttttgtagttgagaggcagccgtgcatgccgatgcacccagacaggcctctggtcatt
aagacaggagtgcagttcaccaacaaagttcggttactcgtaaagttcccagaactgaac
taccagctgaaaattaaagtgtgcattgacaaggaatccagcgatgtggcagccattcga
gggtcacgtaagttcaacatccttggcaccaacaccaaggtgatgaacatggaggagtcc
aacaatggcagcctgtccgcagagttcaaacatttgactttgcgagaacagagatgtggt
aatggtggccggaccaacactgatgcgtccttgatagtgactgaggaacttcacctcatc
acctttgagacagaggtctatcaccagggcctgaagatcgaccttgagacacactctctg
cctgttgttgtcatttctaacatctgtcagatgccaaatgcgtgggcatccattctatgg
tacaacatgctgaccaaccaccccaagaatgtgaacttcttcaccaagcctcctgtgggc
acctgggaccaggtcgctgaggtgctgagctggcagttttcctctacaaccaagagaggc
ctgaccatagaacaactcaccacactggctgagaaattgctggtagagtga

DBGET integrated database retrieval system