KEGG   Elizabethkingia anophelis JM-87: BBD30_14265Help
Entry
BBD30_14265       CDS       T04743                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
een  Elizabethkingia anophelis JM-87
Pathway
een00564  Glycerophospholipid metabolism
een01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:een00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BBD30_14265
Enzymes [BR:een01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BBD30_14265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA HI0933_like Pyr_redox_3 FAD_binding_3 NAD_binding_8 Pyr_redox_2 Thi4 GMC_oxred_N
Motif
Other DBs
NCBI-ProteinID: AQW95260
LinkDB All DBs
Position
complement(3143168..3144769)
Genome map
AA seq 533 aa AA seqDB search
MKRKEELIKVSQNQEWDFIIIGGGASGLGSALDATTRGFRTLLLESHDFAKATSSRSTKL
VHGGVRYLAQGNIDLVKEALYERGLLAKNAAHLVKNQSFIIPNYNWWGGIYYKIGLSVYD
FLAGKLSLGKTRYINKAQTVEKLPTIEQKGLASGVVYQDGQFDDSRLAINLAQTIVEKGG
TVINYTKVVGLLKNESNKITGVIAEDQFTKERYEIKAKAVINATGVFTNEILNMSNPKHG
KFVVPSQGIHFVLDKSFLKSNDAIMIPKTSDGRVLFVVPWHERALIGTTDTLVDEPSFEP
KALDSEIDFVLKTARQYLSKKPTKEDVLSVFAGLRPLAAPKDGSKSTKEVSRSHKVIVAE
TGLVTITGGKWTTYRQMAEDTIDKVIEVHQLKKVASKTKDLSIHGNIPAKDVDRSNHLYI
YGSDIPAIKALQQEKPEYAERIHPNNEFTVAEVIWAIRNEMAETIEDVLARRVRLLFLDA
RAAIDSARKIAEIFAQELGWDAAKVENETESFISLAKEYLLIPYTPNEMKNTN
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaaagaagagcttataaaagtttcacaaaatcaggaatgggactttataatt
atcggaggtggtgccagcggattaggatctgctttggatgctacaacgagaggtttcagg
actttattactggaatcccatgattttgccaaagctacttcgagccggagtaccaaactt
gtgcatggtggtgtaagatacctggcacagggaaacatagatcttgttaaggaagcccta
tacgaaagaggacttctggcgaaaaatgctgctcatcttgtcaaaaaccagtcttttatt
attcctaattataactggtggggcggtatttattacaaaataggactatctgtttacgat
tttctggctgggaaactcagccttggtaaaaccagatatatcaataaagcacaaaccgtt
gaaaagcttccgactatagagcagaaaggtcttgccagcggggttgtatatcaggatgga
cagtttgatgattcccgtctggccattaacctcgcccagactatagtagaaaaaggcggt
accgtaatcaattatacaaaggttgtaggtcttctgaaaaacgaaagtaataaaatcaca
ggagtaatagctgaagatcagtttactaaagaacgttacgaaataaaagcgaaagctgta
attaatgcaacaggagttttcaccaatgaaatcctgaacatgagcaatccaaaacacgga
aaatttgttgttccaagtcagggaattcatttcgtattagataagtctttcttaaagagc
aatgatgctattatgattcctaaaacatctgacgggcgcgtccttttcgttgttccatgg
catgaaagagccttaataggtactactgataccttagtagatgaaccaagtttcgaaccg
aaagctctggattccgaaattgatttcgttttgaaaactgcacggcaatatctgtctaaa
aagccaactaaagaagatgtactttctgtatttgcaggcttacgtcctttagcagctccg
aaagacggaagcaaaagcacaaaagaagtatcccgaagtcataaagttattgtagccgaa
accggacttgtaaccattaccggcgggaaatggactacctaccgacaaatggctgaagat
actatagataaagtaatagaagttcaccaactgaaaaaggttgcttctaaaaccaaagat
ctttccatccacggaaatatcccggcaaaagatgtagacagaagcaatcatttatatatt
tatggttcggatattcctgctataaaagctctacagcaggaaaaaccggaatatgcagaa
agaatacatccaaacaatgaatttaccgttgctgaagttatctgggctatccgaaacgaa
atggctgaaaccattgaggatgtactggccagaagagtccgtcttcttttcttagatgcc
agggcagccatagattcggcgcgaaaaatagcagaaatctttgctcaggaactgggctgg
gatgctgcaaaagtagaaaacgaaactgaaagtttcatttcactcgctaaagaatatctt
cttataccttatacacctaacgaaatgaaaaacactaattaa

DBGET integrated database retrieval system