KEGG   Enterococcus faecium Aus0085: EFAU085_02703Help
Entry
EFAU085_02703     CDS       T02788                                 

Definition
(GenBank) serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
efau  Enterococcus faecium Aus0085
Brite
KEGG Orthology (KO) [BR:efau00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:efau01001]
    EFAU085_02703
Enzymes [BR:efau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     EFAU085_02703
Protein kinases [BR:efau01001]
 Serine/threonine kinases: Other
  Bacterial family
   EFAU085_02703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like APH Kdo Haspin_kinase RIO1 Seadorna_VP7 DUF4366 FTA2 Pox_ser-thr_kin
Motif
Other DBs
NCBI-ProteinID: AGS76655
LinkDB All DBs
Position
complement(2735564..2737633)
Genome map
AA seq 689 aa AA seqDB search
MIELGKKLNGRYQITGNIGSGGMANVFLAHDLILDRDVAVKVLRFDFQNDQTAIRRFQRE
ALAATELVHPNIVSVYDVGEEDNMQYLVMEYVKGMDLKRYIQTHYPVPYETAVNIMQQIL
SAISLAHNHQIIHRDLKPQNVLIDNEGVVKITDFGIAIALSETSITQTNTMLGSVHYLSP
EQARGSMATKQSDIYALGIILYEMLTGSVPFDGESAVTIALKHFQDDLPSIKALDPNVPQ
ALENVILRATAKEPADRYKSAEEMSDDLSTVLSPARANEEKWQPHVMDNETKVITPLTED
APMPDSFKSMPLPKDKPENETLPEEEEVLPDPKKKGQKKWWLILLAILAVLGIGTAVFFA
SGGRGEVVVPDVSDLSEASARETLAKAKLEVATKTEEIADDKIEEGNVVKTDPAAGTTVK
QKREVTLYISSGTKKIKLDDYSGKSYEDAEASLKELGFSADLIQKEEEFSSEVESGMIIS
QSPSEDTEVDPKTDTITFTVSKGPETVTLSSHVGENYETVRNWLVTQGFNINNISATYDY
SDTVPSGSIISQDPASGEVVAEETYINFVVSQGTEPKLNDISGYTKSEAQSYLASVGAEY
IGHETSEYSNTVDKDKVIRTVPGAGTTITKGMVVNVIYSKGPDPASSSSEKDSSDSSSSS
SSSSSTSNSSKEESSSSTSSSASTSESSK
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagttgggcaaaaaattaaatggccgttatcaaatcactggaaatatcggtagc
ggtggtatggcaaatgtatttttggcgcacgatttaatcttggatcgtgatgtagcagtt
aaagtcttacgatttgactttcaaaatgaccagactgcgattcgacgatttcagagagaa
gctttagcagcaacagaactcgttcatccaaacattgttagtgtttacgatgttggtgaa
gaagacaacatgcagtatctggtgatggaatacgtcaaaggaatggacttgaaacgatat
atccaaacacattatcctgttccttatgaaacagcagtaaatattatgcagcagatcctt
tctgctatttctttagctcataaccatcaaatcatccaccgagatttgaaaccccaaaac
gtactgatcgataatgaaggtgttgtaaaaatcacggatttcgggattgctatcgcttta
tctgaaacatcgatcacgcagacgaatacgatgctaggatctgttcattatctgtcccct
gagcaggccagaggaagtatggcaacgaagcagtcagatatttatgctttagggatcatc
ctttatgagatgttgacgggtagcgtaccgtttgatggtgaatctgctgtaacaattgct
ttaaaacattttcaagatgatcttccatctataaaagcacttgatccaaatgtgccacaa
gcactggaaaacgtgattttacgggcaacggctaaagaacctgcagaccgttataagtca
gccgaggaaatgtctgatgatctttctacagtattatcaccagctcgtgcaaacgaagaa
aaatggcagcctcatgtgatggataatgaaacaaaagttatcacaccccttacggaagat
gcaccaatgcctgattcattcaaatctatgcctctgccaaaagacaagccagaaaacgaa
accttaccagaggaggaagaagttctgcctgatcctaaaaagaaaggacagaaaaaatgg
tggctgatcctattagctattcttgctgttttaggaatcggaacagctgtattctttgct
tctggcgggcgaggagaagttgttgttcctgatgtttctgatctttctgaagcttctgct
agagaaacactcgcaaaagcgaaattagaagtagcaacaaaaacagaagaaattgcagat
gacaaaatcgaagaaggtaatgtagtgaagacagacccggcagcgggaacgacagtcaag
caaaaacgcgaagtcactctgtatattagtagcggcacgaaaaaaatcaaattagatgat
tacagtggtaaaagttatgaagatgccgaagcaagtttgaaagaattagggttttctgct
gacttgattcaaaaagaagaggaattcagttcagaggtagaaagcggaatgatcatttcg
caatctccatcagaagatacagaagtcgatcctaaaacagacacgattactttcacagtc
agcaaaggaccagaaacagtgactttgagtagtcatgtaggagaaaactacgaaactgtt
cgtaattggcttgttacacaaggattcaatatcaataatattagtgctacttatgactat
agcgacactgtaccatcaggttcgatcatcagtcaggatccagcctcgggtgaagttgta
gcagaagaaacttacatcaattttgtcgtaagccaaggaacagagcctaaattgaatgat
atctccggctatacaaaaagcgaagcacaaagttatttagctagtgtcggtgcagaatat
atcgggcatgagacttccgaatattcaaacacggtggataaagataaagtgattcgtaca
gtaccaggggcaggaacgacaattaccaaaggaatggttgtgaacgtaatttactctaaa
ggaccagatccagcgtcttctagttctgaaaaagactcttcagacagttctagcagctca
agtagctccagtagcacaagcaactcttcaaaagaagaatcttccagctccacaagttca
tcagctagcacctcagaaagttcaaaataa

DBGET integrated database retrieval system