KEGG   Enterococcus faecium Aus0004: EFAU004_01934
Entry
EFAU004_01934     CDS       T01772                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
efc  Enterococcus faecium Aus0004
Pathway
efc00550  Peptidoglycan biosynthesis
efc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EFAU004_01934
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:efc01002]
    EFAU004_01934
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:efc01011]
    EFAU004_01934
Enzymes [BR:efc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EFAU004_01934
Peptidases and inhibitors [BR:efc01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   EFAU004_01934
Peptidoglycan biosynthesis and degradation proteins [BR:efc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   EFAU004_01934
SSDB
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase RTT107_BRCT_6
Other DBs
NCBI-ProteinID: AFC64018
LinkDB
Position
1958427..1959734
AA seq 435 aa
MSIKKTRLVLLLASLILCLASFLPAVAVQAEDTFKVNAKAAFAVDAQSGKILYDQDGEKT
MGIASITKIIGLYIVLDQVKEGKLSWDDKVSISDYAENLSVTPDLSNVPLHKENTYTVKE
LFDSAIIQSANASMVALAEKISGSEAKFTERMKEQLKDWGIKDATIVNASGLNNSYLGEN
RPEGTGENDENQMSAQDVAIVARHLILDFPEILDVSSTTTQMFGENTQSPVEMVNWNWML
PGFVNYKEGVDGLKTGTTELAGACFVGTITKNDQRIITVVLNADGHAENPSARFNETARL
MDYCYDNWSEKELGKANASIPSLKTIDVKDGKESTVPVVLKSPVKVWVRNDMDTGKLTIT
PTLDKKQVTDNEIQAPMDKGTKIGTATITLAEDKLGYLEDNNAPSTEIITDKTVEKANIF
VIGWRRVAEFFGNLF
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgtccataaaaaaaacacgtctagtcctattattggctagtctcattctttgccttgct
tcttttctaccagctgttgctgtgcaagctgaagatactttcaaagtaaatgcaaaagca
gcctttgctgtagatgcgcaaagcggtaagattctttatgatcaagatggagaaaaaacc
atggggatcgcttcaatcacaaaaatcatcggtctttacatcgtccttgatcaagtaaaa
gaagggaaactatcatgggatgataaagtttcaatttcagattatgcagaaaatttgagt
gtcaccccagatttatcaaatgttcctttgcataaagaaaacacctacaccgttaaagaa
ttattcgactctgcaatcatccagtcagccaacgcttcaatggttgccttggcagaaaaa
atctctggcagcgaagcaaaattcactgaacgaatgaaagaacaattgaaagattggggt
atcaaagatgcaacgatcgttaatgcatcaggactgaataactcttatcttggcgaaaac
cgaccagaaggtactggagaaaacgacgaaaatcaaatgtctgctcaagatgtggctatc
gttgcccgtcatttgatcttggattttccagaaatactggatgtatctagcactacgaca
caaatgtttggcgaaaacacgcaatcaccagtagaaatggtcaactggaactggatgctc
ccaggattcgtgaattataaagaaggcgtggacggattaaaaactggtacgactgaactt
gcaggagcctgtttcgtcggtacgatcactaaaaacgatcaacgaatcatcactgtcgta
ttgaatgcagacggccatgcggaaaacccaagtgcccgtttcaatgaaacagctcgctta
atggattattgctacgacaattggtcagaaaaagagcttggaaaagccaatgcaagtatc
cctagtctaaaaaccattgatgtaaaagacggaaaagaatcaacagtgcccgttgtgctt
aaaagtcctgtaaaagtatgggtacggaacgatatggatactggaaaattaacaatcaca
ccaactcttgacaaaaaacaagtcactgacaatgagatccaagcacctatggataaagga
acaaaaatcggtaccgcaacgatcaccttggcagaagataaattaggttatcttgaagac
aacaacgcgccatccacagaaatcatcacggataaaaccgtagaaaaagcaaatattttc
gttattggctggcgacgcgtcgcagaatttttcggtaacttgttttaa

DBGET integrated database retrieval system