KEGG   Enterococcus faecium T110: M395_08705Help
Entry
M395_08705        CDS       T03257                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
eft  Enterococcus faecium T110
Brite
KEGG Orthology (KO) [BR:eft00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    M395_08705
Enzymes [BR:eft01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     M395_08705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like AlaDh_PNT_C Thi4 FMO-like FAD_binding_3 K_oxygenase Thioredoxin_4 Glutaredoxin NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AII39483
LinkDB All DBs
Position
1778712..1780250
Genome map
AA seq 512 aa AA seqDB search
MVDMLDKETKQNLEQYLALIESPIVFSVSLDTSENSQKLAEFTKEISEMSPKISWEKKEL
TRTPSFSISPLGKESGIVFAGIPLGHEFASFLLALLQISGRAPKISESLSLKIKQIKQTL
HFDSYVSLTCHNCPDVVQALNILAVLNPNITHTMIEGGMFQKEIDDKQIMAVPTVFLNGE
EFSSGRMTIEQIVEKITGPLVEEELFEKKPYDVLVVGGGPAASSAAIYAARKGIRTGIVA
DSFGGQVVETLGIENMIGTPYTEGPKLMQQVENHVRSYPIDIMINQQAVSLNKEQHFINI
GLANGISLQAKTAIIATGAHWRSINVPGEKEFKNKGIAYCPHCDGPLFKGKEIAVIGGGN
SGVEAAIDLAGLAKHVYVLEFLPELKADQILQDKLVSLANVTVIKNAATKEISGTNQVES
LSYIDRRTMEMHTLAVSGVFILVGLLPNTDWLDGTIDMNPRNEIVTEKNGATNIPGVFAA
GDCTDSPYKQIIVSMGSGATAALGAFDYLMRT
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgacatgttagataaagaaactaaacaaaacctcgaacaatatttagcactgatt
gaatctcctattgttttttctgttagtttggatactagtgaaaatagtcaaaaattagca
gaatttacgaaggaaatatcagaaatgtctcctaaaatctcttgggaaaaaaaagagttg
acgcggacacctagtttttctatcagccctcttggcaaagaaagtggaattgtttttgct
ggtatccccctcggtcatgaatttgcttcttttttactagcactgttgcaaattagtgga
cgggcaccgaaaattagcgaatctttgagtctcaaaatcaaacaaatcaaacaaacgctg
cattttgacagttatgtcagcttgacttgtcataattgccccgacgttgtacaggcattg
aatatattagctgtattaaatccaaatattactcatacgatgattgaaggcggtatgttc
caaaaagaaatcgatgataaacaaatcatggcagtgccaacagtgtttttaaatggtgaa
gaatttagtagcggacgcatgacgatcgaacaaatcgttgaaaaaatcactggtcctttg
gttgaagaagaattatttgaaaaaaaaccttatgatgtattagtggtcggtggcggacca
gcagctagtagtgcagctatctatgccgcacgtaaaggaatccgcacagggattgttgct
gactccttcggtggacaagtcgttgaaaccctgggaattgaaaatatgattggtacccct
tacacagaagggccaaaattgatgcagcaagtagaaaatcatgtgcgtagttaccctatc
gatattatgatcaatcaacaggctgtttccttaaataaagagcaacattttatcaatatc
ggcttggctaacggcatatcacttcaagcaaaaacggcaattattgcgacaggtgcacac
tggcgttctatcaatgtaccgggcgaaaaagaatttaaaaataaaggaattgcttattgt
ccacactgtgacggtcctctattcaaaggaaaagagattgctgttatcggtggtggtaat
tctggtgttgaagcagcaatcgatttggctgggttagcaaaacatgtatatgttctagaa
ttcttaccagaattaaaagcagatcaaatcttacaggataaactagtctctcttgcgaat
gtcactgttatcaaaaatgcagcgacgaaagaaatcagcggtacgaatcaggtagaatct
ctctcctatatcgatcgccgtacgatggagatgcatacgctagctgtttcaggagtattc
attctagtcggcttacttcctaatacggattggctagatggaacgatcgacatgaaccca
agaaatgaaatagtgaccgagaaaaatggcgcaacgaatatccccggcgttttcgcagct
ggtgattgtacagatagtccatacaaacaaatcatcgtttcaatgggttcaggagctact
gcagctttaggagcattcgattatctgatgcgcacttga

DBGET integrated database retrieval system