KEGG   Elizabethkingia ursingii: BBD34_01620Help
Entry
BBD34_01620       CDS       T05036                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ego  Elizabethkingia ursingii
Pathway
ego00564  Glycerophospholipid metabolism
ego01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ego00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BBD34_01620
Enzymes [BR:ego01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BBD34_01620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA HI0933_like Pyr_redox_3 NAD_binding_8 Pyr_redox_2 Thi4 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AQX07420
UniProt: A0A1T3FT60
LinkDB All DBs
Position
360662..362263
Genome map
AA seq 533 aa AA seqDB search
MKRKEELTKVSQDQEWDFIIIGGGASGLGSALDATTRGFRTLLLESHDFAKATSSRSTKL
VHGGVRYLAQGNIDLVKEALYERGLLAKNAAHLVKNQSFIIPNYNWWGGIYYKIGLSVYD
FLAGKLSLGKTRYINKAKTVEKLPTIEQKGLASGVVYQDGQFDDSRLAINLAQTIVEKGG
TVINYTKVVGLLKNESNKITGVIVEDQFTKERYEIKTKAVVNATGVFTNDILNMSNPKHG
KFVVPSQGIHFVLDKSFLKSNDAIMIPKTSDGRVLFVVPWHERALIGTTDTLVDEPSFEP
KALESEIDFVLKTARQYLSKKPTKEDVLSVFAGLRPLAAPKDGGKSTKEVSRSHKVIVAE
TGLVTITGGKWTTYRQMAEDTIDKAIEVHNLKKVPSKTKDLSIHGNIPAKDVDRSNHLYI
YGSDIPAIKALQQEKPEYAERIHPNNEFTVAEVVWAIRNEMAETIEDVLARRVRLLFLDA
RAAIDSARKVAEIFAQELGWDAEKVENETESFISLAKEYLLVPYNTNEMKNSK
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaaagaagagcttacaaaagtttcacaagatcaggaatgggactttataatt
atcggaggtggtgccagcggactaggatctgctctggatgctacaacgagaggtttcaga
accttgttactggaatcccatgattttgccaaagctacttcgagccggagtaccaaactt
gtgcatggtggtgtaagatacctggcacagggaaacatagaccttgtgaaggaagcccta
tatgaaagaggacttctggcgaaaaatgctgctcaccttgttaaaaatcagtcttttatt
attcctaattataactggtggggcggtatatattataaaataggattgtctgtttatgat
tttctggcagggaaacttagcctgggtaaaaccagatatatcaataaagcaaaaaccgta
gaaaaacttccgaccatagaacaaaaaggtcttgccagcggagttgtatatcaagacgga
cagtttgatgattcccgtcttgccattaaccttgcccagactattgtagaaaaaggcggt
actgtaatcaattatacaaaggttgtaggtcttttgaaaaacgaaagcaataaaattacg
ggagtaatagttgaagatcagtttactaaagaacgttacgaaataaaaacgaaagctgta
gttaatgcaacaggagttttcaccaatgatatcctgaacatgagtaatcctaaacacgga
aaattcgttgttcctagtcagggaatccatttcgtattagataaatcattcctgaagagt
aatgatgctattatgatccctaaaacatctgacggacgtgtccttttcgttgttccatgg
catgagagagccttaatcggtactactgatacattagtggatgagccgagtttcgaaccg
aaagctctggaatccgaaattgatttcgttttgaaaactgcacgacaatatctgtctaaa
aagccaactaaagaagatgtactttctgtatttgcaggcttacgtcctctagcagcacca
aaagacggaggcaaaagcacaaaagaagtatcccgaagtcataaagttattgtagccgaa
accggtcttgtaaccattaccggtggaaaatggactacctaccgacaaatggcagaagat
actatagataaagcaatagaagttcataacctgaaaaaagttccttctaaaactaaagat
ctttctatccacggaaatatcccggcaaaagatgttgacagaagtaatcacttgtatatt
tatggttcggatattccggctataaaagcattgcaacaggaaaagcctgaatatgcagag
agaatacatccgaacaatgaatttacagttgctgaagttgtatgggcaatccgaaatgaa
atggccgaaactatagaggatgtgctggccagaagggtccgtcttcttttcttagatgcc
agagcagccatagattcagcgcgaaaagtagcagaaatttttgctcaggagctcggctgg
gatgctgaaaaagtagaaaacgaaactgaaagtttcatttcactcgctaaagaatatctt
cttgtaccctataacaccaacgaaatgaaaaactctaaataa

DBGET integrated database retrieval system