KEGG   Eucalyptus grandis (rose gum): 104421226Help
Entry
104421226         CDS       T03547                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr03030  DNA replication
egr03410  Base excision repair
egr03420  Nucleotide excision repair
egr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:egr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    104421226
   03410 Base excision repair
    104421226
   03420 Nucleotide excision repair
    104421226
   03430 Mismatch repair
    104421226
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:egr03032]
    104421226
   03400 DNA repair and recombination proteins [BR:egr03400]
    104421226
Enzymes [BR:egr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     104421226
    6.5.1.6  DNA ligase (ATP or NAD+)
     104421226
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     104421226
DNA replication proteins [BR:egr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    104421226
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     104421226
DNA repair and recombination proteins [BR:egr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     104421226
   NER (nucleotide excision repair)
    Other NER factors
     104421226
   MMR (mismatch excision repair)
    Other MMR factors
     104421226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 104421226
NCBI-ProteinID: XP_010031411
LinkDB All DBs
Position
Unknown
AA seq 815 aa AA seqDB search
MFFLRSCCHCRSPRLALNPRLVPPLARPLFSAAKPFSSSSSSSSSLRRPLSLCSSSSPPP
PPRKRGMSSKPSAFDALMSGARSRAAAAAAAKKKPPPPSPKKRKSPDPAPAENPSDASKP
DSVAVEARADESKAVAGGSQLIEEVKGSNPEKCPDQKKAKKGDSSAERVKELKGKIHLLK
KKPADFSPKAVACWGEGERVPFVFVCLAFDLISNESGRIVITDIVCNALRTVMTTTPDDL
VAAVYLLANRIAPAHEGLELGIGDASIIKALAEACGRTDVQIKKQYKELGDLGLVAKASR
SSQSTMRKPDALTVAKVFDTFRLIAKESGQNSQEKKKNHIKALLVAATDCEPQYLIRLLQ
TKLRIGLAEQTLLAALGQAAVYAEKHSKPSTDVQSPLEEAAKIVKQAYSILPVYDKIVPA
LLTDGVWNLPKLCTFSLGVPVGPMLAKPTKGVSEILSKFQNMVYTCEYKYDGERAQIHYK
EDDSVEIYSRNAEHNTGKFPDVVATVSRLKKEAVKSFVLDCELVAYDQEKKKILPFQILS
TRARKNVVLSEIKVDVCIYAFDMLYLNGKPLIQEQLKLRREHLYDSFKEEPGFFQFATAI
TSNDIEEIQTFLDASVNASCEGLIIKTLDRDATYEPSKRSNNWLKLKKDYMDSIGDSVDL
VPIAAFHGRGKRTGVYGAFLLACYDSSNEEFQSICKIGTGFSEAMLEERSASLRSKVIPK
PKTYYRYSDTISPDVWFEPSEVWEVKAADLTISPVHRAAVGTVDPDKGISLRFPRLVRVR
EDKAPEQASSSDLIAEMYFAQKHNHPNNKDEDEDD
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgttcttccttcgctcgtgctgccattgccgctctccacgcctcgctctaaatcccagg
ctcgtcccccctctcgctcggcccctcttctccgccgctaaacccttctcctcctcctcc
tcctcctcctcctccctccgccgccccctctcgctctgctcctcctcctcgccaccgccg
ccgccgcggaagcgcgggatgtcgtcgaagccctcggcgttcgacgccctcatgtccggc
gcccgctcccgcgccgccgccgccgccgccgccaagaagaagccgccgcctccctcgccg
aagaagcgcaagtcccccgatcccgccccggccgaaaaccctagcgacgcctcgaagccc
gattcggtcgcggtcgaggctagagccgatgaatcgaaggctgtcgccggagggagccag
ctgattgaagaagtcaagggctcgaatccggagaaatgccccgaccagaaaaaggcgaag
aaaggggattcgtctgccgagagagtgaaggaattgaagggcaaaatccatttgctgaag
aagaagccggccgatttctccccgaaggccgtggcttgctggggcgagggcgagagggtt
ccgttcgtatttgtgtgcttggcgttcgacctgatatcgaatgagtcggggaggattgtg
attacggacattgtgtgtaatgcgttgaggactgtgatgaccacgaccccggatgatttg
gtcgctgctgtgtacctgttggccaacaggattgctcccgctcacgaggggctggagctg
ggaatcggggatgcgtcgatcattaaggcgctcgctgaggcctgtggaaggacagacgtg
cagattaagaagcaatacaaggagttgggagatttgggccttgtcgctaaagcaagtcga
tcatctcaatccacaatgcgcaagcctgatgcattaactgttgccaaagtatttgatacg
tttcggctcatagctaaggaatcggggcagaatagtcaggaaaagaaaaagaaccatata
aaagcgcttcttgttgcagccactgattgtgaacctcaatatttgatccgcctacttcag
acaaaattgaggattggattagcagagcagactctcttagctgcacttggacaagctgct
gtatatgctgaaaaacattctaaaccatccacagatgttcaatctcctcttgaagaggca
gcaaagatcgttaagcaagcgtactccattcttccagtttatgataaaatagttcctgct
cttctcactgacggtgtatggaatcttccaaagttgtgtactttttctttgggggtccct
gttggacctatgcttgcaaaaccaacaaaaggtgtctcggagattttaagtaaattccag
aacatggtatacacgtgtgaatacaagtatgatggggagcgtgcacagatacattataag
gaggatgattctgtcgagatatatagtagaaatgctgaacataacactggcaaatttcca
gatgttgttgccacagtatcaagattaaagaaggaagccgttaaatcatttgttctagat
tgtgaacttgtcgcttatgatcaagaaaagaaaaagattcttcctttccagatcctcagt
acgcgagctcgcaaaaatgtagttttgagtgagatcaaggtggatgtttgcatatatgct
tttgacatgctttatttaaatggcaagccacttattcaggaacagctcaaacttcggagg
gagcatctatacgattcattcaaggaagaacccggattttttcagtttgccactgcaata
acatctaatgatatagaggagatacaaacgtttcttgatgcttctgttaatgcaagttgt
gaaggtttgattatcaaaacgctggatcgagatgctacatatgagccttcaaagaggtca
aataactggctgaaattgaagaaagattatatggacagtattggcgattcagtagatttg
gtgcctattgctgctttccatggtcgtgggaagcgtacaggtgtgtatggcgcatttctc
cttgcttgttatgacagttccaatgaagagtttcaaagcatttgtaaaattggaactggt
ttttctgaagccatgcttgaagaacgatctgccagtcttcgctctaaggttattccaaag
ccaaagacatattatcgttattcagatacaatcagtccagatgtgtggtttgaaccttct
gaggtttgggaggtgaaagctgcagatttaactattagccctgttcatcgtgctgcagtt
ggaacagtagatcctgataagggaatctctctccggtttcctcgtttagttcgtgtccgt
gaagataaagcaccggagcaagcaagctcatcagatctgattgcagagatgtattttgct
cagaagcacaatcacccgaataataaagatgaggatgaagatgactga

DBGET integrated database retrieval system