Elaeis guineensis (African oil palm): 105042622 Help Entry 105042622         CDS       T03921                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism egu  Elaeis guineensis (African oil palm) Pathway egu03083   Polycomb repressive complex egu04120   Ubiquitin mediated proteolysis egu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:egu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105042622    04120 Ubiquitin mediated proteolysis     105042622   09126 Chromosome    03083 Polycomb repressive complex     105042622  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:egu04131]     105042622    04121 Ubiquitin system [BR:egu04121]     105042622    03036 Chromosome and associated proteins [BR:egu03036]     105042622 Membrane trafficking [BR:egu04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     105042622 Ubiquitin system [BR:egu04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    SCF complex     Adaptor protein      105042622    Cul7 complex      105042622 Chromosome and associated proteins [BR:egu03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      105042622   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      105042622 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ SPP1_GP23-1 Motif Other DBs NCBI-GeneID:  105042622 NCBI-ProteinID:  XP_010918205 UniProt:  A0A6I9R5R5 LinkDB All DBs Position 4:8304536..8307070 Genome browser AA seq 161 aa AA seqDB search MASAAEIEKKIVLRSSDGVEFEVEEPTARQSKLIGNMIDDGCAENTIPLFNVDAKTLDKV IEYCRKHAGTTSALGECHNTDKEIESWDAAYIDVDQTILYDILLAANYLDIKALLDLGCE QVANMMKAKRAEEIRKIFKIKNDFTPEEEEKIQMEYPWAFN NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atggcgtcggcagctgagatagagaagaagatcgttctaagaagctcagacggcgtggaa tttgaagtggaggagccaacggcgaggcagtcgaagttgatcggcaacatgatcgacgat ggctgcgcggagaacacgatccctctcttcaacgtcgatgccaagaccctcgacaaggtg atcgagtactgcaggaagcatgccggcaccaccagtgcactcggcgaatgccataatacc gacaaggagatcgagagctgggatgctgcatatattgatgtagatcagaccatcctttat gacattcttctggctgccaattatctcgatatcaaggctctcttggaccttggatgcgaa caagtggctaacatgatgaaggcgaagagagcggaggagatccgtaagatttttaaaatt aagaatgacttcactccagaggaggaggaaaagatccaaatggagtacccgtgggccttc aactga

DBGET integrated database retrieval system