KEGG   Elaeis guineensis (African oil palm): 105052990Help
Entry
105052990         CDS       T03921                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00020  Citrate cycle (TCA cycle)
egu00190  Oxidative phosphorylation
egu01100  Metabolic pathways
egu01110  Biosynthesis of secondary metabolites
egu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105052990
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    105052990
Enzymes [BR:egu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     105052990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_7 Fer4_18 Fer4_9 Fer4_20
Motif
Other DBs
NCBI-GeneID: 105052990
NCBI-ProteinID: XP_010932282
LinkDB All DBs
Position
10
AA seq 289 aa AA seqDB search
MAAARFLLRRSSFAAARRLLPTHPPLPTAASSAAARLVPAQAHSSQSSPPSAQPKRMKTF
SIYRWNPDDPTKPQLQKYEIDLAECGPMVLDALIKIKNEVDPSLTFRRSCREGICGSCAM
NIDGDNGLACLTKISSAESPTTITPLPHMFVIKDLVVDMTNFYNQYKSVEPWLKRKDPPP
VPGKEIIQSKKDRAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHAHRWIQDSRD
QYTKERLEAVNDEFKLYRCHTIKNCVHACPKGLNPAKQIESIKKLELQK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcgagatttctcctccgccgcagctccttcgccgccgcccgccgcctcctc
ccgacccatccaccgctccccaccgccgcctcgtccgcggcagcgcggctggtcccggcg
caggcccactcctcgcaatccagtcccccgtccgcccagcccaagcggatgaagaccttc
tccatctaccgctggaaccccgacgatcccaccaagccccagctccagaaatacgagatc
gacctcgccgagtgcggtcccatggtcctcgacgccctgatcaagatcaagaacgaggtc
gacccctccctcaccttccgccgctcctgccgcgagggcatctgcggctcctgcgccatg
aacatcgacggcgacaatggccttgcctgcctcaccaagatctcgtcggccgagtcgccg
acgacgatcacgccactgccgcacatgttcgtgatcaaggacttggtggtcgatatgact
aatttctataaccagtacaagagcgtggagccgtggctcaagcgcaaggacccgccgcca
gtccccgggaaggaaatcatccagagcaagaaggatcgtgcgaagctggacgggatgtat
gagtgtattctctgcgcctgctgcagcacctcctgccccagctactggtggaacccggag
tcgtatctcggtcccgctgcgctcctccatgcccataggtggatacaggacagccgggac
caatacacaaaggagcgtcttgaggctgtcaatgatgagttcaaactctaccgctgccac
actataaagaactgtgttcatgcctgcccgaaaggattgaaccctgcaaagcaaattgaa
tctattaaaaagctcgaactccagaagtaa

DBGET integrated database retrieval system