KEGG   Enterococcus gilvus: EGCR1_06170Help
Entry
EGCR1_06170       CDS       T05664                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
egv  Enterococcus gilvus
Pathway
egv00970  Aminoacyl-tRNA biosynthesis
egv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egv00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EGCR1_06170
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:egv03029]
    EGCR1_06170
Enzymes [BR:egv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     EGCR1_06170
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     EGCR1_06170
Mitochondrial biogenesis [BR:egv03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    EGCR1_06170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AXG38322
UniProt: A0A345FRE0
LinkDB All DBs
Position
complement(1272618..1274087)
Genome map
AA seq 489 aa AA seqDB search
MEKLYDKSIEELHTLLVSKEITATDLTNETFDRIKETEEKVDAFITLNEEKALEMAKAID
AKGISDENALAGIPIGIKDNIVTKGLLTTAASKILSNFDPIYDATVMEKVYSSDLIPVGK
LNMDEFAMGSSSETSYFKKTKNAWDQTKVPGGSSGGSAAAVAAGEVPVSLGSDTGGSIRQ
PAAFNGVVGLKPTYGRVSRFGLIAFASSLDQIGPFTRTVKDNALALNAISGYDPKDGTSA
GVSVPDFASGLTGDIKGMKIALPKEFMAEGIEPGVKAAITKAVETFKALGATVEEVSLPH
SKYGVEVYYIIASSEASSNLQRFDGIRYGFRSEDVQNLEDVYVNTRTEGFGDEVKRRIML
GTFSLSAGYYDAYFKKAGQVRTLIKQDFDKVFADYDLIIGPTSPTVAFGIGENINDPITM
YLNDILTIPVNLAGLPGMSVPAGFSDGLPVGLQIIGKHFDESTMYKAAYAFEQATDFHKQ
KPVILGGDK
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattatatgataaatcaatcgaagaattacacactcttttggtttcaaaagaa
atcacggcaacggacttaacaaacgaaacattcgaccggatcaaagagactgaagagaaa
gtcgatgcgttcattactttaaatgaagaaaaagcattagaaatggctaaagcgatcgat
gcaaaaggtatctctgatgaaaatgctttagcgggtattccaatcggtatcaaagataac
atcgtgacaaaaggactattgacgaccgctgcatcgaaaattttatctaattttgatcct
atttatgatgcaacagtcatggagaaggtttacagctctgacttgatcccagtaggtaaa
ctcaacatggatgagtttgcgatgggaagttcgagcgaaacatcttactttaagaaaacg
aaaaatgcttgggatcaaacaaaggttcccggcggttcttcaggtggttctgctgcagca
gtggctgctggagaagtccctgtttctttagggagtgatacgggtggtagtattcgccaa
ccggcagcatttaatggggttgtcggattaaaaccaacttatggacgtgtctctcgtttt
ggtctgattgcatttgcttcatcgttggatcaaattggaccctttacccgcaccgtaaag
gacaatgcgttagcgttaaacgcgattagcggctacgaccctaaagatgggacttcagct
ggtgtctctgttcctgattttgcttctggtttaacaggagatattaaaggaatgaagatc
gctttgccaaaagaatttatggcagagggaatcgaaccgggcgtcaaagcagcaattacg
aaagcagtagaaacctttaaagcattaggggcaactgttgaagaagttagcctgccgcat
tcaaaatatggggtagaagtctattacatcatcgcttcatccgaagcaagctctaatttg
caacgctttgatggtattcgctatggattccgttctgaagacgttcaaaacttagaagat
gtgtatgtcaacactcggactgaaggttttggtgatgaagtgaagcgtcggatcatgcta
ggaacattctcactttctgctggatattatgatgcatactttaagaaagctggacaagtt
cggacattgatcaaacaagactttgataaggtctttgcagattacgatctgatcattggt
ccaacctcaccaactgtggcatttggcattggtgaaaatatcaatgatccaatcacgatg
tatttgaacgatattttgacgatccctgtgaacttggcaggattgccaggtatgtctgtt
cctgccggattctctgacggattgccggtcggtctgcaaatcatcggcaagcattttgat
gagtcaacgatgtacaaagccgcctatgcctttgaacaggcaacggatttccataagcaa
aaaccagtgattttagggggggacaaataa

DBGET integrated database retrieval system