KEGG   Enterococcus gilvus: EGCR1_10200Help
Entry
EGCR1_10200       CDS       T05664                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
egv  Enterococcus gilvus
Brite
KEGG Orthology (KO) [BR:egv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EGCR1_10200
Enzymes [BR:egv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EGCR1_10200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored AlaDh_PNT_C FAD_binding_3 DAO Thi4 HI0933_like Thioredoxin_4 FMO-like Glutaredoxin LPD7 Ribosomal_L21p K_oxygenase Auto_anti-p27
Motif
Other DBs
NCBI-ProteinID: AXG39064
UniProt: A0A345FTI2
LinkDB All DBs
Position
2085249..2086781
Genome map
AA seq 510 aa AA seqDB search
MLDNETKEQLKQYLALLESKIVFSASLDESEDSKKVEDFLTEVAAMDDKILIETKKLTRT
PSFEINRVGAEASGIGFAGLPMGHEFTSFILALLQVGGRAPKIEDAVKQQIQSIERALTF
ETYVSLTCHNCPDVVQALNIMAVLNPNISHTMIEGGMYQAEVDEKEVMAVPTVFLNGEEF
DSGRMTIEQILEKVSGPMGAGEFADKETFDVLVVGGGPAGASSAIYAARKGIKTGMVVET
FGGQVLETLGIENVIGTPYVEGPQLMRQVEEHVKQYDVDIMKGQRAKAIRKNDLIEVELE
NGAQLTAKTAILSTGARWRAINVPGEKEFKNKGIAYCPHCDGPLFKDKEVVVIGGGNSGI
EAAIDLAGLAKHIYVLEFLPELKADQVLQEKLYSLTNVTVITNAATKEITGSSHVEALTY
TDRLTNEEHTLQVEGVFILIGLMPNTEWLTESVALSDRGEILVDKHGATNVEGIFAAGDC
TDSAYKQIIISMGSGATAALGAFDYLIRNT
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgttagataacgaaacgaaagaacagcttaaacaatatttagcgttattagaatcaaaa
atcgttttttctgccagtttagacgaatctgaagattcaaaaaaagtggaagatttcttg
actgaagtcgcagcgatggacgacaagattttgattgaaacaaaaaaattaacgcggaca
cctagctttgagatcaatcgcgttggtgcagaagcgagcggcatcggctttgcaggattg
ccaatggggcatgaattcacgtcctttatccttgccctgctgcaagttggcggacgcgca
ccaaaaattgaagatgcagtcaagcagcagattcaatccatcgaaagagcattgaccttt
gaaacctacgtcagcttaacgtgccacaactgcccagacgtcgtgcaagccttgaacatt
atggctgtactgaaccctaacatctctcataccatgatcgaaggcgggatgtatcaggca
gaagtggatgaaaaagaagtcatggctgtaccgactgttttcttgaacggtgaagaattc
gacagcggtcggatgacgatcgaacaaattcttgaaaaagtcagtggaccaatgggtgcg
ggtgaatttgcggataaggaaacctttgacgtgttagtcgttggcggcggaccagctggt
gccagttcggcgatctacgcggcacgtaaggggatcaagactggaatggtcgtagagacc
tttggcggacaagtcctggaaacgttgggaatcgaaaacgtgatcggaacaccttacgtt
gaaggcccgcaattgatgcgtcaagtagaagaacacgtgaagcaatacgacgttgacatc
atgaaggggcaacgggcgaaagccattcgaaaaaatgatctgatcgaagtggaattggag
aacggtgcacagctgaccgcgaaaacggccatcctttcaacaggtgcacgttggcgtgct
atcaatgttcccggagaaaaagagttcaaaaacaaaggaatcgcgtattgtcctcactgt
gacggccctctatttaaagataaagaagtggtcgttatcggcggcggaaattcagggatc
gaagcagcgatcgacttagctgggttagccaaacatatttatgtattggaattcttgcct
gaattgaaggctgaccaagtattgcaagagaagctatactcattgaccaatgtcacggtg
atcaccaatgcagccacaaaagaaatcaccgggtcttcacacgtagaagcattgacgtat
acggaccgtctgaccaatgaagaacataccttgcaagtagagggcgtcttcatcttgatc
ggattgatgccgaatactgaatggcttactgaatctgtcgctttaagcgatcgtggtgag
atcttagtcgacaagcacggtgccaccaacgtagaaggaatctttgcggcaggcgattgt
accgacagcgcctataagcaaatcatcatttctatgggttcaggggctactgcggctctt
ggcgcctttgattatttaatccgcaacacttaa

DBGET integrated database retrieval system