KEGG   Egretta garzetta (little egret): 104134499
Entry
104134499         CDS       T05152                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04010  MAPK signaling pathway
egz04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:egz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104134499 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104134499 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:egz04052]
    104134499 (KITLG)
Cytokines and growth factors [BR:egz04052]
 Growth factors
  Growth factors (RTK binding)
   104134499 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 104134499
NCBI-ProteinID: XP_009646342
LinkDB
Position
Unknown
AA seq 473 aa
MRFAAVLRKPSTQRANGPWLTSSHLVNQELVPHWKWARLIKTCSLTGYEHVFSKEDSNSV
TAAGMDLPAGLHALKIKCRFSTPSTNTLFTRCANCNSVLEDLQDHLYTSIRRHCSTTFLW
LEQEKDVHNLAKLENGFSLQLEKSIEEKVVLYGHLAEKSCSCQLSLGIPEVPHGKASECA
KQHRCHCCVQKTETWIITCFCLQLLLLNPLVKAQSSCGNPVTDDVNDIAKLVGNLPNDYM
ITLRYVPKMDSLPDYCWLNLMVPEFSKSLHSLLQKFSDISDMSDVLSNYSIINNLTRIIN
DLMACLAFDKKKDFVKENGHLYKEGRFIPEDFFRRFNITIEVYKEFADTSDKNDCILPST
VETPENDSRVAVTKTFLFPPVAASSLRNDSIGSNTSSNKEVLGFISSSSLQGISIALTSL
LSLLIGFILGAIYWKKTHPKSRPESGETTQCHDCQEENEISMLQQKEKEHLQV
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgcggtttgcagctgtgcttaggaaaccttccactcaacgcgcgaatggtccgtggcta
actagttctcacctggtaaatcaagagttggtaccacattggaaatgggcacgactaata
aaaacctgctctcttacgggttatgaacacgtcttctccaaagaggactcaaattctgtc
actgctgctgggatggatttgccagctggactccacgcactaaaaatcaagtgtcgtttt
tccacacccagcaccaatacattatttacacggtgtgcaaactgtaacagcgtgttagaa
gacctgcaggatcacctttacacaagcattaggaggcactgctcaacaacttttctgtgg
ctggagcaggaaaaagatgtgcataacttggcaaaactagagaacggcttctccttgcag
ctggagaaaagtattgaagaaaaagtagttctgtatgggcatttagctgaaaaatcctgc
tcttgtcagttgtccctaggcattccagaagtccctcacgggaaagcaagtgagtgtgca
aagcagcatcgctgtcactgctgtgtgcaaaagacagaaacttggattatcacttgcttt
tgtcttcaactactcctacttaaccctcttgtgaaagctcagagttcctgcgggaatcca
gtgacagatgatgtgaatgacattgcaaaattggttggaaatctcccaaatgattatatg
ataacccttagatatgtcccgaagatggatagtctgcctgattactgttggctgaatttg
atggtgcctgaattttcaaagagtctacatagtctgctccagaaattttcagatatttca
gatatgtctgatgttttaagcaactattcaatcatcaataatctcacaaggataattaat
gatcttatggcatgcctagcttttgataaaaaaaaggattttgtaaaagaaaatggtcac
ctttataaagaaggtcgctttattcctgaggatttttttaggcgctttaatattaccatt
gaggtctacaaggagtttgcagacacatcggataagaatgactgcattctgccttcaaca
gtagaaacaccagagaatgattccagagtcgctgtcacaaaaacatttttgtttcctcct
gttgctgccagctcccttaggaatgacagcattggcagtaacactagcagtaacaaagag
gtacttggcttcattagcagctccagcctgcaaggcatcagcatagcactgacatcattg
ctgtctcttcttattggctttattttgggagccatatactggaagaaaacacatcccaaa
tccagaccagaaagtggtgaaactacacagtgtcatgactgtcaagaggaaaatgagata
agtatgttgcagcaaaaagaaaaagaacatctacaggtgtag

DBGET integrated database retrieval system