KEGG   Egretta garzetta (little egret): 104135209Help
Entry
104135209         CDS       T05152                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00590  Arachidonic acid metabolism
egz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    104135209 (PTGS1)
Enzymes [BR:egz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     104135209 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 104135209
NCBI-ProteinID: XP_009647128
LinkDB All DBs
Position
Unknown
AA seq 564 aa AA seqDB search
LPGSPLNPCCYFPCQHQGVCMRVGLGGYECDCTRTGYFGANCTSPELWTRLHNLLKPSPA
FYHFVLTHFRWFWNIINSTFIRDTLMRLVLTVRANLIPSPPTFNSDYGYISWEAYANVSY
YTRVLPPVPDNCPTPMGTKGKQQLPDPQLLAERFLLRQKFEADPQGTNLMFAFFAQHFTH
QFFKTSGKMGRGFTKALGHGAFTGMVFSPAPFLPSHSCLPKVVDGEMYPPMVTDAPVHMV
YPSAVPKEKQLAMGQEVFGLLPGLCMYTTLWLREHNRVCDILKREHPTWSDEQLFQTARL
ILIGETIKIVIEDYVQHLSGYFLSLKFDPELLFGTQFQYRNRIAVEFNQLYHWHGLMPDS
FIIQGEEYSYEQFLYNTSMLIDYGVEALVESFSKQIAGRIGGGKTINANVLKVAIGVIKE
SRQLRLQPFNRKRFGMKPYKTFQELTGEEETAAELEELYGDIDALEFYLGLLLEKPQPNG
IFGESMVEIGAPFSLKGLLGNPICSPEYWKPSTFGGATGFEIVKTASLEKLVCLNVKKCP
YVAFRVPDAAENGSPKAGGSSTEL
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
ctcccaggcagccccttgaatccctgttgctatttcccctgccagcaccaaggggtgtgc
atgagggtcggcctgggcgggtacgagtgtgactgcacgcggacgggatacttcggggcc
aactgtacctcccctgagctctggacgcgcctccacaacctgctgaagcccagtcctgcc
ttctaccacttcgtcctgacccacttcaggtggttttggaacataatcaacagcaccttc
atcagggacacgctcatgaggctggtgctcacagttcgtgccaatctcatccccagcccc
cccaccttcaactctgactacggctacatcagctgggaggcctacgccaacgtcagctat
tacacccgtgtcctcccacctgtgccggacaactgcccgacgcccatggggaccaaaggg
aagcagcagctccccgacccccagctcctggcggagaggttcctgctgcggcagaagttt
gaagccgatccccaaggcaccaacctgatgtttgccttcttcgcccagcatttcacccac
cagttcttcaagacgtccgggaagatgggacgtggcttcaccaaggcgctggggcacggg
gctttcaccggcatggttttctcccctgctccctttctgccatcccattcttgtctccct
aaggtggtggatggagagatgtacccccccatggtcaccgatgctccggtccacatggtc
tacccgtctgctgttcccaaggagaagcagctggcgatggggcaggaggtgtttgggctg
ctgccggggctctgcatgtacaccacactctggctgcgcgagcacaaccgcgtctgcgac
atactgaaacgggagcatcccacctggagcgacgagcagctcttccagacggctcgtctc
atcctcatcggggagaccattaagatcgtcattgaagactacgtccagcatctcagcggg
tacttcctcagcctcaagtttgaccctgagctgctgtttgggacgcagttccagtaccgg
aatcgcatcgcggtggagttcaaccagctctatcactggcatgggctgatgcctgactcc
ttcatcatccaaggggaagagtacagctatgagcagttcctctacaacacttccatgctg
atagactacggcgtggaggcgctggtggagtccttttccaagcagattgcaggaaggatc
ggtgggggaaaaaccatcaacgctaacgtcttgaaagtggccattggggtcatcaaggaa
tcccggcagctgaggctacagccatttaatcggaagaggtttggcatgaagccctacaag
acctttcaggagctaacaggagaggaagagacggcggcagagctggaagagctatatgga
gacatcgatgctctggagttttatctgggcttgctgcttgagaaacctcagcccaatggt
atttttggagaaagcatggtggagataggagctccgttttccctgaaggggcttcttgga
aaccccatctgctccccagagtactggaaacccagtacctttggcggagcaactggcttt
gagatagttaagacagcatcactcgagaaactcgtgtgcctcaatgtgaagaagtgccca
tacgtggcattccgtgtgccagatgctgcagaaaacggcagccctaaggctggtggatca
tctactgagctctag

DBGET integrated database retrieval system