KEGG   Ethanoligenens harbinense: Ethha_2110Help
Entry
Ethha_2110        CDS       T01384                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
eha  Ethanoligenens harbinense
Brite
KEGG Orthology (KO) [BR:eha00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eha01001]
    Ethha_2110
Enzymes [BR:eha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Ethha_2110
Protein kinases [BR:eha01001]
 Serine/threonine kinases: Other
  Bacterial family
   Ethha_2110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like APH Pkinase_fungal RIO1 THOC2_N MazG_C Seadorna_VP7 PIP49_C FTA2 Kdo ETRAMP FERM_F2
Motif
Other DBs
NCBI-ProteinID: ADU27627
UniProt: E6U3M7
LinkDB All DBs
Position
complement(2256976..2258967)
Genome map
AA seq 663 aa AA seqDB search
MENMIGRKLDGRYAIQEVIGVGGMAIVYKAYDEIDDRVVAVKVLKDEYLSNEDFKRRFKN
ESKAIAMLSHPNIVKVYDVSLDERLQYIVMEYVDGITLKEYIDQQHVLTWKEAVHFTVQI
LRALQHAHEKGIVHRDIKPQNIMMLEDGTIKVADFGIARMANSETRTMTDKAIGSVHYIS
PEQASGSRTDEKSDIYSLGVMLYEMLTGKLPFDSENAVSVAIMQMQTDPRRPRELNPDIP
EGLEEITLRAMQKEPARRYVSAAAMLADINAFKQNPSIHFAYKYFVDDSPTRYYDAVKKV
KGEPEPEKQPEVAPKKEAAKKNKSYISLLSKIAIVFILIAAVIIGIMMYVFGIFPHSATP
DVKVPNLVGQQYDTVVQQYGKELQIVKSNTQYDNTAPAGQILSQNPKANADVKKNAQVSV
VVSLGPKQVTVPDVTNLAQADAVAQLTANGLQYTIQSINDDSVAKGSVVKTDPVAGTQVN
SGSSVTLYISLGPVVVNETVPNVVGMTQDAAKTALENAGLKLGNVTQQSSSTVAAGTVIS
QDQKANTQIPQNTAVNLVVSSGTPSAPNVVGESISKATSDLQNNGYSLGNVTYANNSTVA
QGDVISQQTESDNKHVDLVVSLGPATSSVSSTSSTASTSSTSSTTTSTTTTTTNTYHSSR
GRK
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacatgatcggcagaaagctggacggcagatacgccatacaggaagtcatcggc
gtgggcggcatggccattgtctacaaagcctacgacgagatcgacgaccgcgtggtcgcc
gtcaaggtgctcaaagacgaatatctctccaacgaggatttcaaacgccggttcaagaac
gaatccaaggccattgccatgctgtctcacccaaacatcgtgaaggtgtacgatgtcagc
ctggatgagcgcctgcagtacatcgtcatggaatatgtagacggcatcaccctcaaggaa
tacatcgaccagcagcatgtgctcacctggaaagaggccgtgcattttaccgtgcagatt
ctgcgcgcgctgcagcatgcgcatgaaaagggcatcgtgcaccgggacatcaagccgcag
aacatcatgatgctggaggacggcaccatcaaggtggccgatttcggcatcgcgcgcatg
gccaacagtgaaacccgcaccatgaccgacaaagccatcggctcggtgcattacatcagc
ccggagcaggccagcggcagtcgcacggatgaaaaatccgacatctactcgctgggcgtc
atgctgtatgagatgctcaccggcaagctgccgtttgactcggaaaacgccgtgtcggtc
gccatcatgcagatgcagaccgatccccgccgcccgcgcgagctcaaccccgatatcccg
gaggggctggaggagatcacgctgcgcgccatgcagaaggagcccgccaggcggtatgtc
tccgcggcggccatgctggctgatatcaacgcgttcaagcaaaaccccagcatccatttt
gcatataaatattttgtggacgacagccccacccggtattatgacgcagtgaaaaaggtc
aagggggaaccggagccggaaaaacagccggaagtcgctcccaaaaaagaggcggccaaa
aagaataaatcctatatcagtctgctgtccaagatcgccatcgtgtttatcctcatcgcg
gcggtcatcatcggcatcatgatgtatgtgttcggtatctttccgcatagcgccaccccg
gatgtcaaggtgcccaatctcgtgggccagcagtacgatacggtggtgcagcagtatggc
aaagagctgcagatcgtcaagtccaacacgcagtacgacaacaccgcaccggccgggcag
attctgtctcaaaacccgaaagccaatgcagacgtgaagaaaaacgcgcaggtctcggtg
gtggtcagcctggggccgaagcaggtcaccgtgccggatgtgaccaatttggcccaggcc
gacgcggtggcgcagctcaccgcgaacgggctgcaatacaccatccagtcgattaatgac
gacagcgtggcaaaaggctcggtcgtcaagaccgacccggtggcgggcacgcaggtcaat
tccggctcgagtgtcacgctctatatcagcctcgggccggtcgtcgtcaatgagacggtg
ccgaacgtggtgggcatgacgcaggatgcggccaagaccgcgctggaaaacgccgggttg
aagctgggcaatgtgacacagcagagcagttcgacggttgccgccggcaccgttatctcg
caggaccagaaggccaacacgcagattccgcagaacacggcggtcaatctggtggtgagc
agcggtacaccatcggccccgaatgtggtcggtgaatcgataagcaaagcaacgagtgat
cttcagaataatggatactcgcttggcaatgtgacatatgccaataacagcacggtggcg
cagggagatgtcatcagccaacaaacggaatcggacaacaagcatgtggatttagtggtg
agcctcggtccggcaacgagcagtgtatctagtacgtccagcacagctagtacgtccagc
acatccagcacgacaaccagtacgacaaccaccacgacaaacacctatcattcctcccgt
gggcgcaaatga

DBGET integrated database retrieval system