KEGG   Enterobacter hormaechei CAV1176: AB284_19065Help
Entry
AB284_19065       CDS       T04593                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ehm  Enterobacter hormaechei CAV1176
Brite
KEGG Orthology (KO) [BR:ehm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AB284_19065
Enzymes [BR:ehm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AB284_19065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored NAD_binding_8 HI0933_like FAD_binding_3 Thi4 K_oxygenase Glutaredoxin FMO-like DAO AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ANS18633
UniProt: A0A2G5AEP5
LinkDB All DBs
Position
complement(3789530..3791095)
Genome map
AA seq 521 aa AA seqDB search
MLDANMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKALLTEIAELSPKVTFKEDNTLAV
RKPSFLIANPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITERNVMGVPAVYLNGQE
FGQGRMTLTEIVAKVDTGAEKRAAEELNQRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASKLVPAAVEG
GLHQIETASGAVLKARSVIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLNNVDIVLNAQTTEVKGD
GSKVTGLEYRDRVSGDIHSVALAGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSSFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgctaacatgaaaacccagctcaaggcctaccttgagaaactgaccaaacct
gttgagctgattgccacgctggacgacagcgcgaaatcggcagaaatcaaagcgctgctg
acagagattgctgagctgtcgccgaaggtgaccttcaaagaagacaacacgctggcagtc
cgtaagccttctttcctgatcgccaacccagggtctgaccaggggccgcgtttcgcgggc
tctccgctggggcacgaatttacgtccctggtgctggcgctgctgtggaccggtggtcat
ccgtcaaaagaagcgcaggcgctgctggagcagatccgcgatatcgacggtgattttgag
tttgaaacctattactcactctcctgccataactgtccggacgtggtgcaggcgctgaac
ctgatgtcagtcctcaacccacgcattaagcacacggcgattgacggcggtacgttccag
aacgaaatcaccgagcgcaacgtgatgggcgttccggcggtttacctgaatggtcaggag
ttcggccaggggcgtatgaccttgaccgaaatcgtcgccaaagtggataccggcgcagaa
aaacgtgcggcggaagagttgaaccaacgcgatgcgtacgacgtactgattgttggctcc
ggcccggcgggcgcagcggcggcggtgtactccgcacgtaaagggatccgtaccggtctg
atgggcgagcgtttcggtggtcaggttctggataccgttgacattgaaaactacatttcc
gtgccgaaaaccgaaggccagaagctggccggggcgttgaaagcgcacgtcagcgactac
gacgtggatgtcattgatagccagagcgccagcaaactggttccggccgcggtcgagggt
ggtttgcaccagattgaaacggcgtccggcgcggtgctgaaggcgcgcagcgtgatcatt
gccaccggcgcgaaatggcgcaacatgaacgtcccgggcgaagatcagtatcgcaccaaa
ggcgtgacctattgcccgcactgtgacggcccgctgttcaaaggtaaacgcgtagcggtg
atcggcggcggtaactccggcgtggaagcggctatcgatctggcgggaattgttgaacac
gttaccctgctggaattcgccccggagatgaaagcggaccaggtgttgcaggataaggtg
cgtagcctgaataacgtcgatattgtgctcaatgcccagacgacagaagtgaaaggcgac
ggcagcaaagtgaccggtctggaataccgtgaccgcgtgagtggcgatattcacagcgtg
gcgctggcagggatctttgttcagattggcctgctgccaaacaccacctggctggaaggc
gcgattgagcgcaaccgcatgggcgagatcatcattgatgcgaaatgcgaaaccagcgtg
aagggcgtatttgcggcgggcgactgcaccaccgtgccgtacaaacagatcatcatcgcc
actggcgaaggtgcgaaagcgtcgctgagctcgtttgattatctgatccgcaccaaaacc
gcataa

DBGET integrated database retrieval system