KEGG   Edwardsiella ictaluri: NT01EI_0352
Entry
NT01EI_0352       CDS       T00912                                 

Definition
(GenBank) Protein of unknown function (DUF1525)
Organism
eic  Edwardsiella ictaluri
SSDB
Motif
Pfam: DUF1525 RPN13_C gpW Thioredoxin_2
Other DBs
NCBI-ProteinID: ACR67594
UniProt: C5BDH8
LinkDB
Position
355278..355673
AA seq 131 aa
MKLRDFILLPALLPVSVLAGTVVYTDSQHLPENLSPGVVAVLLDAPERLQAKMFGQLSTD
PEQAAAQVRLAMSSPQWQQKQQQLVAAYRQVVHAWELGIRKVPAVVFDDRDVVYGTTDVA
QALRLQAGGDQ
NT seq 396 nt   +upstreamnt  +downstreamnt
atgaaattacgtgattttatccttctgccggcattgttgccggtgtccgttctggccggc
acggtggtctataccgacagccagcacttacctgaaaatctttctccgggtgttgtagct
gtgttgctggatgcacctgaacgtctgcaggcgaaaatgtttggtcagctttcgacagac
ccagagcaagctgctgcacaggtaaggctggcgatgtcatcccctcagtggcagcaaaaa
cagcaacagttggttgcagcatatcgccaggtggtacatgcctgggagcttgggatccgc
aaagtgcccgctgtcgtttttgacgatagggatgtggtctatggcacaaccgatgtagcg
caggcactgcggctgcaagctggaggtgatcagtga

DBGET integrated database retrieval system