Escherichia coli clone D i2: i02_1092 Help Entry i02_1092          CDS       T02004                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism eld  Escherichia coli clone D i2 Pathway eld01100   Metabolic pathways eld01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eld00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     i02_1092   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     i02_1092 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding GshA Motif Other DBs NCBI-ProteinID:  AER83676 LinkDB All DBs Position complement(1121790..1122041) Genome browser AA seq 83 aa AA seqDB search MTDQQTIYQEVSALLVKLFEIDPQDIKPEARLYEDLELDSIDAVDMIVHLQKKTGKKIKP EEFKAVRTVQDVVEAVERLLQEG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgacagaccaacaaaccatttatcaggaagtctcagccctgctggttaagctgtttgaa atcgatccgcaggacatcaaacctgaagcgcgactgtacgaagatctggaactggacagc atcgacgccgttgacatgattgtgcacctgcaaaagaaaaccggtaagaaaatcaagccg gaagagtttaaagcagtgcgtacagtccaggatgttgtcgaggctgtagaacgcctgcta caagaaggctaa

DBGET integrated database retrieval system