KEGG   Enhydra lutris kenyoni (northern sea otter): 111142106
Entry
111142106         CDS       T05871                                 

Definition
(RefSeq) serine/threonine-protein kinase TBK1 isoform X1
  KO
K05410  TANK-binding kinase 1 [EC:2.7.11.10]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04014  Ras signaling pathway
elk04137  Mitophagy - animal
elk04140  Autophagy - animal
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04622  RIG-I-like receptor signaling pathway
elk04623  Cytosolic DNA-sensing pathway
elk04657  IL-17 signaling pathway
elk05014  Amyotrophic lateral sclerosis
elk05022  Pathways of neurodegeneration - multiple diseases
elk05135  Yersinia infection
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111142106
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111142106
   04137 Mitophagy - animal
    111142106
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111142106
   04621 NOD-like receptor signaling pathway
    111142106
   04622 RIG-I-like receptor signaling pathway
    111142106
   04623 Cytosolic DNA-sensing pathway
    111142106
   04657 IL-17 signaling pathway
    111142106
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    111142106
   05022 Pathways of neurodegeneration - multiple diseases
    111142106
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111142106
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111142106
   05161 Hepatitis B
    111142106
   05160 Hepatitis C
    111142106
   05171 Coronavirus disease - COVID-19
    111142106
   05164 Influenza A
    111142106
   05162 Measles
    111142106
   05168 Herpes simplex virus 1 infection
    111142106
   05163 Human cytomegalovirus infection
    111142106
   05167 Kaposi sarcoma-associated herpesvirus infection
    111142106
   05169 Epstein-Barr virus infection
    111142106
   05165 Human papillomavirus infection
    111142106
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     111142106
Protein kinases [BR:elk01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   111142106
Membrane trafficking [BR:elk04131]
 Autophagy
  Xenophagy
   Other xenophagy associated proteins
    111142106
SSDB
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD PK_Tyr_Ser-Thr Pkinase_fungal DUF713 Kinase-like CEP63 ubiquitin
Other DBs
NCBI-GeneID: 111142106
NCBI-ProteinID: XP_022350770
UniProt: A0A2Y9IXV6
LinkDB
Position
Unknown
AA seq 781 aa
MVVRARSLPPLLLTPLGGPLTGALPGQRSATLGTKKEVVLITRLTRTPDQAEMQSTSNHL
WLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIV
KLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRE
NGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERA
VLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISG
VQKAENGPIDWSGDMPISCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHR
MIIHVFSLQQMTAHKIYIHSYNTATVFHELVYKQTKIISSNQELIYEGRRLVIEPGRLVQ
HFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACKV
ASTLLLYQELMRKGIRWLIELVKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKI
NLEAAELGEISDIHTKLLRLSSSQGTIETSLQDVESKLSPGGLLADSWAHQEGTHPKDRH
VEKLQVLLNCITEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKK
YEAFLDKSEEWMRKMLHLRKQLLSLTNQCFDIEEEVSKYQDYTNELQETLPQKMFAASSG
IKHTMTAIYPCSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDC
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggtcgtgcgggcccggtcccttccacctctacttctcacccccctgggcggccctctg
accggggccctcccgggtcagcgttcagcgacgttgggcacgaagaaagaggtggtgctc
attacccgtttaacaagaactcctgaccaagccgagatgcagagcacttctaatcatctg
tggcttttatctgatattttaggccaaggagctacggcaaatgtctttcgtggaaggcat
aagaaaactggtgacttatttgctatcaaagtatttaataacataagcttccttcgtcca
gtggatgttcaaatgagagaatttgaagtgttaaaaaaactcaatcacaaaaatattgtc
aaattatttgctattgaagaggagacaacaacaagacataaagtacttattatggaattt
tgtccatgcggaagtttatacactgttttagaagagccatctaatgcctatggactacca
gagtctgaatttttaattgttttgcgagatgtggtcggtggaatgaatcatctccgagag
aatggcatagtgcaccgtgatatcaagccagggaatatcatgcgtgttataggggaagat
ggacagtctgtgtacaaactcacagattttggtgcagctagagaattagaagatgatgag
cagtttgtttctctgtatggcacagaagaatatttgcatcctgatatgtatgagagagca
gtcctgagaaaagatcatcagaagaagtatggagcaacggttgatctttggagcattggg
gtaacattttaccatgcagctactggatccctgccatttagaccatttgaagggccacgt
aggaataaggaagtgatgtataaaataataactggaaagccttctggtgcaatatctggt
gtacagaaagcagaaaatggaccaatcgactggagtggagacatgcctatttcttgtagt
ctttctcggggtcttcaggttctacttacccctgttcttgcaaacatcctggaggcagat
caggaaaagtgttggggttttgaccagttttttgcagaaactagtgatatacttcatcga
atgataattcatgttttttcactgcaacaaatgacagctcataagatttatattcatagc
tataatactgctactgtatttcatgaactggtgtataaacaaaccaaaattatttcttca
aatcaagaacttatatatgagggacgacgtttagtcatcgaacctggaagactggtacag
catttccctaaaacgacggaagaaaatcccatctttgtagtaagtcgggaacctctgaat
accataggattgatatatgagaaaatttccctccctaaagtacatccacgttatgattta
gatggggatgctagcatggctaaggcaataacaggagttgtgtgttatgcctgtaaagtt
gccagtaccttgctgctttatcaggaattaatgcgaaaggggatacgatggttgatagaa
ttagttaaagatgattataatgaaactgttcacaaaaagacagaagttgtgatcacattg
gatttctgtatcagaaacattgaaaaaactgtgaaagtatacgaaaagttgatgaagatc
aacctagaagcagcagaattaggtgaaatttcagacatacacaccaaattgttgagactt
tccagttctcagggaacaatagaaaccagtcttcaggatgtcgaaagcaaattatctcca
ggtggattgctggcagattcatgggcccatcaagaaggcactcatccaaaagatagacat
gtagaaaagctacaagtcctgctaaattgcatcacagagatttactatcagttcaaaaaa
gacaaagcggaacgtagattagcttacaatgaagaacagatccacaaatttgataagcaa
aaactgtattaccatgcaacaaaagctatgacccactttacagacgaatgtgttaaaaaa
tatgaggcatttttggataagtcagaagaatggatgagaaagatgcttcatcttaggaaa
cagttattatccctaactaatcagtgttttgatattgaagaagaagtatcaaagtatcaa
gactatacaaatgagttacaagaaactttgccccagaaaatgtttgcagcctccagtgga
atcaaacataccatgaccgcaatttatccatgttctaatacattagtggaaatgactctt
ggtatgaagaaattaaaggaagaaatggaaggggtggttaaagaacttgctgaaaataat
catatcttagaaaggtttggctctttaaccatggatggcggccttcgcaatgttgactgt
ctttag

DBGET integrated database retrieval system