KEGG   Enhydra lutris kenyoni (northern sea otter): 111143174
Entry
111143174         CDS       T05871                                 

Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk04010  MAPK signaling pathway
elk04012  ErbB signaling pathway
elk04024  cAMP signaling pathway
elk04137  Mitophagy - animal
elk04210  Apoptosis
elk04310  Wnt signaling pathway
elk04380  Osteoclast differentiation
elk04510  Focal adhesion
elk04530  Tight junction
elk04620  Toll-like receptor signaling pathway
elk04621  NOD-like receptor signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04657  IL-17 signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04668  TNF signaling pathway
elk04722  Neurotrophin signaling pathway
elk04912  GnRH signaling pathway
elk04915  Estrogen signaling pathway
elk04921  Oxytocin signaling pathway
elk04926  Relaxin signaling pathway
elk04932  Non-alcoholic fatty liver disease
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk05030  Cocaine addiction
elk05031  Amphetamine addiction
elk05132  Salmonella infection
elk05133  Pertussis
elk05135  Yersinia infection
elk05140  Leishmaniasis
elk05142  Chagas disease
elk05161  Hepatitis B
elk05162  Measles
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05210  Colorectal cancer
elk05211  Renal cell carcinoma
elk05224  Breast cancer
elk05231  Choline metabolism in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05321  Inflammatory bowel disease
elk05323  Rheumatoid arthritis
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111143174
   04012 ErbB signaling pathway
    111143174
   04310 Wnt signaling pathway
    111143174
   04668 TNF signaling pathway
    111143174
   04024 cAMP signaling pathway
    111143174
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    111143174
  09143 Cell growth and death
   04210 Apoptosis
    111143174
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111143174
   04530 Tight junction
    111143174
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111143174
   04621 NOD-like receptor signaling pathway
    111143174
   04625 C-type lectin receptor signaling pathway
    111143174
   04660 T cell receptor signaling pathway
    111143174
   04658 Th1 and Th2 cell differentiation
    111143174
   04659 Th17 cell differentiation
    111143174
   04657 IL-17 signaling pathway
    111143174
   04662 B cell receptor signaling pathway
    111143174
  09152 Endocrine system
   04912 GnRH signaling pathway
    111143174
   04915 Estrogen signaling pathway
    111143174
   04921 Oxytocin signaling pathway
    111143174
   04926 Relaxin signaling pathway
    111143174
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111143174
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111143174
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111143174
   05203 Viral carcinogenesis
    111143174
   05231 Choline metabolism in cancer
    111143174
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111143174
  09162 Cancer: specific types
   05210 Colorectal cancer
    111143174
   05211 Renal cell carcinoma
    111143174
   05224 Breast cancer
    111143174
  09163 Immune disease
   05323 Rheumatoid arthritis
    111143174
   05321 Inflammatory bowel disease
    111143174
  09165 Substance dependence
   05030 Cocaine addiction
    111143174
   05031 Amphetamine addiction
    111143174
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111143174
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111143174
   04933 AGE-RAGE signaling pathway in diabetic complications
    111143174
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111143174
   05135 Yersinia infection
    111143174
   05133 Pertussis
    111143174
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111143174
   05170 Human immunodeficiency virus 1 infection
    111143174
   05161 Hepatitis B
    111143174
   05171 Coronavirus disease - COVID-19
    111143174
   05162 Measles
    111143174
   05167 Kaposi sarcoma-associated herpesvirus infection
    111143174
   05169 Epstein-Barr virus infection
    111143174
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    111143174
   05142 Chagas disease
    111143174
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111143174
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111143174
Transcription factors [BR:elk03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    111143174
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 FlaC_arch NBP1 TFIIA Jnk-SapK_ap_N Fib_alpha DUF3450
Other DBs
NCBI-GeneID: 111143174
NCBI-ProteinID: XP_022352398
UniProt: A0A2Y9IV49
LinkDB
Position
Unknown
AA seq 334 aa
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASAAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQLPVQHPRLQALKEEPQTVPEMPG
ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST
ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatgccctgaacgcctcgttcctccag
tccgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggccgacccggtgggcagcctgaaaccgcacctccgggccaagaactcggacctc
ctcacctcgcccgacgtggggctgctcaagctggcctcgcccgagctggagcgcctgata
atccagtccagcaacgggcacatcaccaccacgccgacccccacgcagttcctgtgcccc
aagaatgtgacagacgagcaggagggcttcgccgagggtttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctgcccagcgtcacgtcggcggctcagccggtcagcggggcg
ggcatggtggcaccggcggtggcttcggcggcgggtggcagcggcagcggcggcttcagt
gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccgggcgcg
ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcag
ccccagcagcagcagcagcccccgcagccgccgcaccacctgccccagcagctcccggtg
cagcacccgcggctgcaggccttgaaggaggagccgcagacggtgcccgagatgcccggg
gaaacgccgcccctgtcccccatcgacatggagtcgcaggagaggatcaaggcagagagg
aagcgcatgaggaaccgcatagctgcctccaagtgccggaaaaggaagctggagaggatc
gcccggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacg
gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac
agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system