KEGG   Enhydra lutris kenyoni (northern sea otter): 111144322
Entry
111144322         CDS       T05871                                 

Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk04010  MAPK signaling pathway
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04068  FoxO signaling pathway
elk04071  Sphingolipid signaling pathway
elk04072  Phospholipase D signaling pathway
elk04140  Autophagy - animal
elk04150  mTOR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04210  Apoptosis
elk04218  Cellular senescence
elk04270  Vascular smooth muscle contraction
elk04360  Axon guidance
elk04370  VEGF signaling pathway
elk04371  Apelin signaling pathway
elk04510  Focal adhesion
elk04540  Gap junction
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04613  Neutrophil extracellular trap formation
elk04625  C-type lectin receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04666  Fc gamma R-mediated phagocytosis
elk04720  Long-term potentiation
elk04722  Neurotrophin signaling pathway
elk04726  Serotonergic synapse
elk04730  Long-term depression
elk04810  Regulation of actin cytoskeleton
elk04910  Insulin signaling pathway
elk04912  GnRH signaling pathway
elk04914  Progesterone-mediated oocyte maturation
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04917  Prolactin signaling pathway
elk04919  Thyroid hormone signaling pathway
elk04921  Oxytocin signaling pathway
elk04926  Relaxin signaling pathway
elk04928  Parathyroid hormone synthesis, secretion and action
elk04929  GnRH secretion
elk04935  Growth hormone synthesis, secretion and action
elk05010  Alzheimer disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05034  Alcoholism
elk05132  Salmonella infection
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05170  Human immunodeficiency virus 1 infection
elk05200  Pathways in cancer
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05210  Colorectal cancer
elk05211  Renal cell carcinoma
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05218  Melanoma
elk05219  Bladder cancer
elk05220  Chronic myeloid leukemia
elk05221  Acute myeloid leukemia
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05230  Central carbon metabolism in cancer
elk05231  Choline metabolism in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111144322
   04012 ErbB signaling pathway
    111144322
   04014 Ras signaling pathway
    111144322
   04015 Rap1 signaling pathway
    111144322
   04370 VEGF signaling pathway
    111144322
   04371 Apelin signaling pathway
    111144322
   04630 JAK-STAT signaling pathway
    111144322
   04068 FoxO signaling pathway
    111144322
   04072 Phospholipase D signaling pathway
    111144322
   04071 Sphingolipid signaling pathway
    111144322
   04024 cAMP signaling pathway
    111144322
   04022 cGMP-PKG signaling pathway
    111144322
   04151 PI3K-Akt signaling pathway
    111144322
   04150 mTOR signaling pathway
    111144322
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111144322
  09143 Cell growth and death
   04210 Apoptosis
    111144322
   04218 Cellular senescence
    111144322
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111144322
   04540 Gap junction
    111144322
   04550 Signaling pathways regulating pluripotency of stem cells
    111144322
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111144322
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    111144322
   04625 C-type lectin receptor signaling pathway
    111144322
   04650 Natural killer cell mediated cytotoxicity
    111144322
   04660 T cell receptor signaling pathway
    111144322
   04662 B cell receptor signaling pathway
    111144322
   04664 Fc epsilon RI signaling pathway
    111144322
   04666 Fc gamma R-mediated phagocytosis
    111144322
   04062 Chemokine signaling pathway
    111144322
  09152 Endocrine system
   04910 Insulin signaling pathway
    111144322
   04929 GnRH secretion
    111144322
   04912 GnRH signaling pathway
    111144322
   04915 Estrogen signaling pathway
    111144322
   04914 Progesterone-mediated oocyte maturation
    111144322
   04917 Prolactin signaling pathway
    111144322
   04921 Oxytocin signaling pathway
    111144322
   04926 Relaxin signaling pathway
    111144322
   04935 Growth hormone synthesis, secretion and action
    111144322
   04919 Thyroid hormone signaling pathway
    111144322
   04928 Parathyroid hormone synthesis, secretion and action
    111144322
   04916 Melanogenesis
    111144322
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111144322
  09156 Nervous system
   04726 Serotonergic synapse
    111144322
   04720 Long-term potentiation
    111144322
   04730 Long-term depression
    111144322
   04722 Neurotrophin signaling pathway
    111144322
  09158 Development and regeneration
   04360 Axon guidance
    111144322
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111144322
   05206 MicroRNAs in cancer
    111144322
   05205 Proteoglycans in cancer
    111144322
   05230 Central carbon metabolism in cancer
    111144322
   05231 Choline metabolism in cancer
    111144322
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111144322
  09162 Cancer: specific types
   05210 Colorectal cancer
    111144322
   05212 Pancreatic cancer
    111144322
   05225 Hepatocellular carcinoma
    111144322
   05226 Gastric cancer
    111144322
   05214 Glioma
    111144322
   05221 Acute myeloid leukemia
    111144322
   05220 Chronic myeloid leukemia
    111144322
   05218 Melanoma
    111144322
   05211 Renal cell carcinoma
    111144322
   05219 Bladder cancer
    111144322
   05215 Prostate cancer
    111144322
   05213 Endometrial cancer
    111144322
   05224 Breast cancer
    111144322
   05223 Non-small cell lung cancer
    111144322
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111144322
   05022 Pathways of neurodegeneration - multiple diseases
    111144322
  09165 Substance dependence
   05034 Alcoholism
    111144322
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111144322
   05152 Tuberculosis
    111144322
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111144322
   05161 Hepatitis B
    111144322
   05160 Hepatitis C
    111144322
   05164 Influenza A
    111144322
   05163 Human cytomegalovirus infection
    111144322
   05167 Kaposi sarcoma-associated herpesvirus infection
    111144322
   05165 Human papillomavirus infection
    111144322
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111144322
   01522 Endocrine resistance
    111144322
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111144322
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111144322
Protein kinases [BR:elk01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   111144322
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 111144322
NCBI-ProteinID: XP_022354272
UniProt: A0A2Y9J054
LinkDB
Position
Unknown
AA seq 668 aa
MEHIQGAWKTISNGFGFKDTVFDGPSCISPTIVQPFGFQRRASDDGKLTDSSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
NSSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIENNSLNASPRAWSRRFCLRGRDA
IRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSY
YWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKT
RHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLH
AKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQ
DNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKA
MKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLT
TSPRLPVF
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggagcacatacagggggcctggaagacgatcagcaacggttttggattcaaagacaca
gtgtttgacggccccagctgcatctcgcctacaatagttcagccatttggctttcagcgt
cgggcgtcagatgatggcaaacttacggactcgtctaagacaagcaacactatccgtgtt
ttcttgccaaacaagcaaagaacagtggtcaatgtgcgaaatggaatgagcttgcacgat
tgccttatgaaggcactcaaggtgaggggcctacagccggagtgctgtgctgtgttcaga
cttctccatgaacataaaggtaaaaaggcacgtttagattggaatactgatgctgcctcg
ttgattggagaagaacttcaagtagatttcctggatcacgttcccctcacaacacacaac
tttgcacggaagacctttctgaagcttgcgttctgtgacatctgtcagaagttcctgcta
aatggatttcgttgtcagacttgtggctacaaatttcatgagcactgtagcaccaaagtt
cctactatgtgtgtggattggagtaatatcagacagctcttattgtttccaaattctact
attggtgatagtggggtcccagcactgccttctttgactatgcgtcggatgcgagagtct
gtttcccggatgcctgttagttcccagcacagatattccacaccccatgccttcacattc
aactcctccagcccttcctctgaaggttccctttcccagaggcagaggtccacatccaca
cctaatgtccacatggtcagcaccaccctgcctgtggacagcaggatgattgagaataac
agcctgaatgcttctcccagggcgtggtccagacgattttgtttgaggggaagagatgca
attcgaagccacagtgaatcagcctcaccttcagccttgtccagcagccctaacaatctg
agcccaacaggctggtcacagcccaaaacccctgtgccagcacagagagagcgggcacca
ggatctgggacccaggagaaaaacaaaattaggcctcgtggacagagagattcaagctat
tactgggaaatagaagccagcgaagtgatgctctccactcggattgggtcaggctccttt
ggaacggtgtataagggcaagtggcacggagatgttgcagtaaaaatcctaaaggttgtc
gaccccacaccagagcagttccaggccttcaggaacgaggtggctgtcctccgcaaaaca
cggcatgtgaacatcctgctcttcatggggtacatgacaaaggacaacctggcgattgtg
acccagtggtgtgaaggcagcagcctctacaaacacctgcatgtccaggagactaaattc
cagatgttccagttgattgacatcgcccgccagactgctcagggaatggactatttgcat
gcaaagaacatcatccatagagacatgaaatccaacaatatatttctccatgaaggcctg
acggtgaaaattggagattttggtttggcaacagtaaagtcgcgctggagtggttctcag
caagttgaacaacccactggctctgtcctgtggatggcgcctgaggtgatccgaatgcag
gataacaacccgttcagcttccagtctgatgtctactcctacggcattgtgctctatgag
ctcatgacaggggagcttccttactcccacatcaataaccgtgatcagatcatcttcatg
gtgggccgagggtatgcctccccagacctcagtaagctatataagaactgccccaaagca
atgaagaggcttgtagccgactgtgtgaagaaggttaaggaagagaggcctctttttccc
cagatactgtcttccatcgagctgctccaacattctctgccgaaaatcaaccggagcgct
tctgagccatccctgcaccgggcggcccacactgaggatatcaacgcctgcacactgact
acgtcccctagactgcctgtcttctag

DBGET integrated database retrieval system