KEGG   Enhydra lutris kenyoni (northern sea otter): 111144914
Entry
111144914         CDS       T05871                                 

Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00480  Glutathione metabolism
elk00980  Metabolism of xenobiotics by cytochrome P450
elk00982  Drug metabolism - cytochrome P450
elk00983  Drug metabolism - other enzymes
elk01100  Metabolic pathways
elk01524  Platinum drug resistance
elk05200  Pathways in cancer
elk05204  Chemical carcinogenesis
elk05225  Hepatocellular carcinoma
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111144914
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    111144914
   00982 Drug metabolism - cytochrome P450
    111144914
   00983 Drug metabolism - other enzymes
    111144914
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111144914
   05204 Chemical carcinogenesis
    111144914
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111144914
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111144914
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111144914
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:elk02000]
    111144914
Enzymes [BR:elk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     111144914
Transporters [BR:elk02000]
 Other transporters
  Pores ion channels [TC:1]
   111144914
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_3 GST_C_2 GST_C_5
Other DBs
NCBI-GeneID: 111144914
NCBI-ProteinID: XP_022355226
UniProt: A0A2Y9J3Z5
LinkDB
Position
Unknown
AA seq 212 aa
MRFCPYAQRTLLVLKAKGIRREIININLKSKPEWFFKKNPFGLVPVLENSQDQLIYESAI
TCEYLDDVYPGKKLLPDDPYEKARQKMVFELFSKVPSLVTSVLRKQNEEDCSGQKELRKE
LSKLEEVLTNKKTTFFGGNSLSMIDYLIWPWFERMEILELNDCVEHTPKLKLWMAAMRKD
PAVSALLIEPKALQGFLKLYLQNSPEACDYGL
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaggttctgcccgtatgcccagaggacactcctggttctgaaggccaagggaatcagg
cgtgaaatcatcaacatcaacctgaaaagtaagcctgagtggttctttaagaagaatccc
tttggcctggtgccagttctggaaaacagtcaggatcaactgatctacgaatctgccatc
acctgtgagtacctggatgatgtatatccaggaaagaagctattgccagacgacccctat
gagaaagctcgccagaagatggtgtttgagttattttctaaggtcccatctttggtaaca
agtgttttgagaaaacagaatgaggaagactgctctggccaaaaagaattgcggaaagaa
ctcagcaagctagaggaggttcttaccaataagaagacaaccttctttggtggcaattct
ctttctatgattgactaccttatctggccctggtttgaacgaatggaaattctggagtta
aatgattgtgtagaacatactccaaaacttaagctctggatggcagccatgaggaaagat
cctgcggtatcagcccttctcatcgagcccaaggcccttcaaggtttcctcaaactctac
ttgcagaacagccccgaggcctgtgactatgggctctga

DBGET integrated database retrieval system