KEGG   Enhydra lutris kenyoni (northern sea otter): 111145738
Entry
111145738         CDS       T05871                                 

Definition
(RefSeq) mitotic spindle assembly checkpoint protein MAD1 isoform X1
  KO
K06679  mitotic spindle assembly checkpoint protein MAD1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04110  Cell cycle
elk04114  Oocyte meiosis
elk04914  Progesterone-mediated oocyte maturation
elk05166  Human T-cell leukemia virus 1 infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111145738
   04114 Oocyte meiosis
    111145738
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    111145738
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111145738
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111145738
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:elk03036]
    111145738
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     111145738
SSDB
Motif
Pfam: MAD
Other DBs
NCBI-GeneID: 111145738
NCBI-ProteinID: XP_022356613
UniProt: A0A2Y9J6K7
LinkDB
Position
Unknown
AA seq 717 aa
MDDLGENTTVLSTLRSLNNFISQRVEAGSGLDAATSAPGSLQTQYQQSMQLEERAERIRS
KSQVVQVEREKMQMELSHKRARVELERAASTSARCYEREVDRNQELLTRIRQLQEREAEA
EEKMKEQLERHRLCEQSLAAAGQKLREKEDGLAAAGETISTLKGRVSELQWSVMNQEMQV
KSLESEKQELKEQLALQHKKCQEANQKVQELQASQEARADQEQRIRDLEQKLSLQEQDAA
VVKNMKSELVRLPKLERELKQLREESAYLREMRETNGLLREELEGLRRQLGRQEKLQESL
VVLELEKEKLLAKLQSWERLEQTTGLSIRTPEDLSGFVVELQRRELALQDRNNTITTSAR
GLEKARQQLQEEVRQVSSQLLEERKKRETQEALARRLQKRVLLLTKERDGMRAILGSYDS
ELTAAEYSPQLTRRMREAEDMVQKVHAHNSEMEAQLSQALEELGGQKQRADMLEMEVKML
QSQSSAAEQGFPLSREEASSLRLKIEELEGERSRLEEDKKMLEMQLERFTLQGGYDQSRT
KVLHMSMNPASAAKQRLREDQARLQEECEQLRELVRALERGGPVPANLEAAASLPSSKEL
TELRKQVESAELKNQRLKEVFQTKIQEFRKVCYALTGYQIDITTENQYRLTSMYAEHKAD
CLIFKATGPSGVKMQLLETAFSSSVQELIELHLLRQDSIPAFLSALTLDLFSRQTVA
NT seq 2154 nt   +upstreamnt  +downstreamnt
atggatgacctgggggaaaacaccactgtgctgtccacgctgcggtctttgaacaacttc
atctctcagcgggtggaggctgggtccggcctggatgctgccacctccgccccaggttct
ctgcagacacagtatcagcagagcatgcagctggaggaacgagcagagcggatccgttcc
aagtcccaggtggtccaggtggagcgggagaagatgcagatggagctgagccacaagaga
gcacgagtggagctggagcgggcggccagcaccagtgccaggtgctacgagcgtgaggtg
gaccgcaaccaggagctgctgacgcgcattcggcagctgcaggagcgggaggctgaggca
gaggagaagatgaaggagcagctggagcgccataggctgtgtgagcagagcctggccgct
gctggccagaagctgcgggagaaggaggacggcctggctgcggctggggagaccatcagc
acgctgaaggggagggtctccgagttgcagtggagcgtgatgaaccaggagatgcaggtg
aagagcctggagtctgagaagcaggagctcaaggagcagctggccttgcagcacaagaaa
tgtcaggaggctaatcagaaggttcaggagctccaggccagccaggaagccagggccgac
caggagcagaggatcagggatctggagcagaagctgtccctgcaggaacaggatgccgca
gtggtgaagaatatgaagtcagagctggtgcggctgcccaagctggagagggagctgaag
cagctgcgcgaggagagcgcctacctgcgggagatgcgggagaccaacgggctgctccgg
gaggagctggaggggctgcggcggcagctgggacgccaggagaagttgcaggagagtctg
gtcgtcctggagctggagaaggagaagctgctggcaaagctgcagagttgggagcggctg
gagcagaccacgggcttgagcatcagaaccccggaagacctgtctgggtttgtcgttgag
ctgcagcggcgggagctggccttgcaggaccggaacaacaccatcaccaccagtgcccga
gggctggagaaggcccggcagcagctccaggaggaggtccgccaggtcagcagccagctg
ctggaggagaggaagaagcgggagacgcaggaggccttggcacggagactccagaagcgg
gtcctgctgctgacgaaggagcgggacggcatgcgcgccatcctgggttcctacgacagc
gagctgactgcggccgagtactcgccccagctgacgcgtcgcatgcgtgaggctgaggac
atggtgcagaaggtgcacgcgcacaactcggagatggaggctcagctgtcgcaggccctg
gaggagctgggaggccagaagcaacgagcagacatgctggagatggaggtgaagatgcta
cagtcccagtccagcgctgctgagcagggcttcccgctgtccagggaggaggccagctca
ctccggttgaagattgaggaactggaaggggagcgcagtcgtctggaagaagacaagaag
atgctggaaatgcagctcgagcggttcaccctgcagggtggctacgaccagagcaggacc
aaagtgctgcacatgagcatgaacccggccagcgcggccaagcagcggctccgcgaggac
caggcccggctgcaggaggagtgtgagcagctgcgggagctcgtgcgcgccctggagcga
ggcggccctgtccccgctaacctggaggccgctgcaagtctgccttcgtccaaggaacta
acagagctgaggaagcaggtggagagcgccgagttgaagaaccagcggctcaaggaggtc
tttcagactaagatccaggagttccggaaagtctgttatgcgctcacgggctaccagatt
gacatcacgacagagaaccagtaccggctgacgtccatgtatgccgagcacaaagccgac
tgtctcatcttcaaggccacaggaccatcgggcgtcaagatgcagctgctggagacggcg
ttctcgagctctgtgcaggagctcatagagctgcacctgctgcggcaagacagcatcccg
gccttcctcagtgccctcaccctcgacctcttcagccgccagaccgtggcctag

DBGET integrated database retrieval system