KEGG   Enhydra lutris kenyoni (northern sea otter): 111152764
Entry
111152764         CDS       T05871                                 

Definition
(RefSeq) protein VAC14 homolog isoform X1
  KO
K15305  vacuole morphology and inheritance protein 14
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk05166  Human T-cell leukemia virus 1 infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111152764
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111152764
SSDB
Motif
Pfam: Vac14_Fig4_bd Vac14_Fab1_bd HEAT HEAT_EZ TAF6_C
Other DBs
NCBI-GeneID: 111152764
NCBI-ProteinID: XP_022367093
UniProt: A0A2Y9K1B0
LinkDB
Position
Unknown
AA seq 830 aa
MNPEKDFAPLTPNIVRALNDKLYEKRKVAALEIEKLVREFVAQNNTVQIKHVIQTLSQEF
ALSQHPHSRKGGLIGLAACSIALGKDSGLYLKELIEPVLTCFNDADSRLRYYACEALYNI
VKVARGAVLPHFNVLFDGLSKLAADPDPNVKSGSELLDRLLKDIVTESNKFDLVGFIPLL
RERIYSNNQYARQFIISWILVLESVPDINLLDYLPEILDGLFQILGDNGKEIRKMCEVVL
GEFLKEIKKNPSSVKFAEMANILVIHCQTTDDLIQLTAMCWMREFIQLAGRVMLPYSSGI
LTAVLPCLAYDDRKKSIKEVANVCNQSLMKLVTPEDDEPDEPKPVLQRQAEPNPDDSLAK
QEGTPSGGPDGSCDSSFSGGGGSVFTPASTERAPVTLHLDGIVQVLNCHLSDMAIGMMTR
IAVLKWLYHLYIKTPRKMFRHTDSLFPILLQTLSDESDEVILKDLEVLAEIASSPAGQTD
DPGPLDGPDLRVSHSELQVPTPGRANLLNTPGTKGLECSPSTPTMNSYFYKFMINLLKRF
SSERKLLEARGAFIIRQLCLLLNAENIFHSMADILLREEDLKFASTMVHTLNTILLTSTE
LFQLRNQLKDLKTLESQNLFCCLYRSWCHNPVTTVSLCFLTQNYRHAYDLIQKFGDLEVT
VDFLTEVDKLVQLIECPIFTSLLCWHVQSRPGNLLHSRPRAPSLPDCSEGRGSGPRPRGS
TGVVRPRARSAQMGRKKEGRCPKDRRGDPGGEGRSAPAALGREEPPTPDQGPVRPAHAAT
AEQRLPASVPPAAVRAQPRAAPDRRQFTSSPEGAESGFPQHRLRRAAAAL
NT seq 2493 nt   +upstreamnt  +downstreamnt
atgaacccggagaaagacttcgcgccgctcacgcccaacatcgtgcgcgccctcaatgac
aagctctacgaaaagcggaaggtggcagcgctggagatcgagaagctggtccgggagttc
gtggcccagaacaacaccgtgcaaatcaagcatgtgatccagaccctatctcaggagttt
gccctgtctcagcacccccacagccggaaggggggcctcatcggcctggccgcctgctcc
atcgcactgggcaaggactcggggctgtacctgaaggagctcatcgagcccgtgctcacc
tgcttcaacgacgccgacagccggctgcgctactacgcgtgcgaggcgctgtacaacatc
gtcaaggtggcccgcggcgccgtgctgccccacttcaacgtgctcttcgacgggctcagc
aagttggctgcagacccagaccccaatgtgaagagtggatctgagctcctagaccgtctt
ttaaaggacattgtgacggaaagcaacaagttcgacctggtgggcttcatccctttgttg
agggagaggatttactccaacaaccagtacgcccgacagttcatcatctcctggatcctg
gttctggagtctgtgccagacatcaacctgctggattatttgccagagatcctggatggg
ctcttccagatcctgggagacaacggcaaagagattcggaaaatgtgtgaggtggtcctt
ggagaattcctgaaagaaattaagaagaacccctccagtgttaagtttgcagagatggcc
aacatcttggtgatccactgccagaccacagatgacctgatccagctgacagccatgtgc
tggatgcgggagttcatccagctggctggccgggtgatgctgccctactcttccgggatc
ctgacggctgtcttgccctgcctggcctacgacgaccgcaagaaaagcatcaaggaggtg
gccaacgtgtgcaaccaaagcctgatgaagctggtcacccctgaggatgacgagcctgac
gagccgaagccagtgctgcagaggcaggcagagcccaaccccgatgattccctggccaag
caggaagggacacccagtggaggccccgatggctcttgtgactccagcttcagtggcggc
ggcggcagcgtcttcacgccagccagcaccgagagggccccagtcaccctccacctcgat
ggcatcgtgcaggtcctcaactgccacctcagcgacatggccattgggatgatgaccagg
atcgccgtcctgaagtggctgtaccacctgtatatcaagactccccgaaagatgttccgg
cataccgacagcctcttccccatcctgctgcagacgctatcggatgaatccgacgaggtt
atcctgaaggatctagaggtgttggcagaaattgcttcctcccctgcaggccagacggat
gacccaggccccctggatggccctgacctccgggtcagccactcagagcttcaggtgccc
acccctggcagagccaacctgctgaatactcccggtaccaaaggcttagaatgttctcct
tccacccccaccatgaactcctacttttataagttcatgatcaaccttctcaagaggttc
agcagtgaacgcaagctcctggaggccagaggcgctttcatcatcaggcagctctgcctc
ctgctgaatgcagagaacatctttcactcgatggcagacatcctgctccgagaggaggac
ctcaagtttgcctcgaccatggtccataccctcaacaccatcctgctcacctccacggag
ctcttccagctgagaaaccagctcaaggacctgaagactctggagagccagaacctattt
tgctgcctctaccgctcctggtgccacaaccctgtcacaaccgtgtccctgtgcttcctc
acccagaactaccggcacgcctacgatctcatccagaagttcggagacctggaggtcaca
gtggatttcctcacagaggtggacaagctggtgcagctgatcgagtgccccatcttcaca
tctctcttgtgttggcacgtgcagagcagaccggggaatctgttacactccaggccccga
gccccctcattaccggactgcagtgagggtaggggctcaggacccaggccccgcggcagc
acaggggtcgtcaggccgagggctcgctcagcacagatgggcaggaagaaagaggggaga
tgccccaaggacaggcgaggtgaccctggaggagaaggcagatctgcgcctgcagctctt
ggacgtgaagagccacccacacctgatcaaggccctgtacggcctgctcatgctgctacc
gcagagcagcgccttccagcttctgtcccgccggctgcagtgcgtgcccaaccccgagct
gctccagaccgaagacagttcacaagcagccccgaaggcgcagaaagcggattcccccag
catcgactacgcagagctgctgcagcactttga

DBGET integrated database retrieval system