KEGG   Enhydra lutris kenyoni (northern sea otter): 111159160
Entry
111159160         CDS       T05871                                 

Definition
(RefSeq) C-C chemokine receptor type 8
  KO
K04183  C-C chemokine receptor type 8
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04062  Chemokine signaling pathway
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111159160
   04061 Viral protein interaction with cytokine and cytokine receptor
    111159160
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    111159160
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111159160
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    111159160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:elk04030]
    111159160
   04050 Cytokine receptors [BR:elk04050]
    111159160
   04090 CD molecules [BR:elk04090]
    111159160
G protein-coupled receptors [BR:elk04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    111159160
Cytokine receptors [BR:elk04050]
 Chemokine receptors
  CC Chemokine
   111159160
CD molecules [BR:elk04090]
 Proteins
  111159160
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 111159160
NCBI-ProteinID: XP_022377300
UniProt: A0A2Y9L777
LinkDB
Position
Unknown
AA seq 355 aa
MDYTLEPNVTTVTDYYYPDIMSSPCDGELIQRDSKLLLAVFYCVLFVFGLLGNILVILVL
VAGKKLRSITDVYLLNLVLSDLLFVFSFPFQTHYQLDQWVFGTVMCKVVSGFYYIGFFSS
MFFITLMSVDRYLAIVHAVYAMKVRTARMGIALSLAVWLIAIMATSPLLVVYQVASEDGI
LQCYSSYNQQTLKWKIFIHFEMNILGLLIPFTILMFCYISILHQLKSCQNHNKTKAIKLV
LIVVIASLLFWVPFNVVLFLTSLLNMNILDGCVLSQRLIYATHVTETISFTHCCVNPVIY
AFMGEKFKKHLSEIFQKISNYGLLFVGRQIPREGWERPPSSCQHPSRSSSTDYIL
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggattatacactggagcccaatgtgacgacggtaaccgactactactatcctgacatc
atgtcaagcccctgcgatggggaactgatccaaagagacagcaagttgcttcttgctgtc
ttttactgtgtcttgtttgtatttggtcttctgggaaacatcctggtcatccttgtcctt
gtagccggcaagaagctgaggagcatcaccgacgtatacctcttgaacttggtcctgtct
gacttgctttttgtcttctccttccccttccagacccactaccagctggaccagtgggtg
tttgggactgtgatgtgcaaggtggtctctggtttttattacattggcttcttcagcagc
atgttctttatcaccctcatgagtgtggacaggtacctggcaatcgtccatgcggtctat
gctatgaaagtgaggacagccaggatgggcatagccctgagtctggccgtgtggttgatt
gctatcatggccaccagcccattactagtggtgtaccaagtggcctctgaagatggcatt
ctacagtgttattcatcttacaatcaacagactctgaagtggaagatcttcatccacttt
gaaatgaatatcttaggtctgttgatcccattcaccatccttatgttctgctacattagc
attctgcaccagctgaagagctgccaaaatcacaacaagaccaaggccatcaaattggtg
ctcattgtggtgatcgcatctttactcttctgggtcccattcaatgtggtcctcttcctc
acttccctgctcaacatgaacatcttggatggatgtgtcctgagccagcgactgatttat
gccactcatgtcacagaaaccatttccttcactcactgctgtgtgaaccctgtgatctat
gctttcatgggtgagaaattcaagaaacacctctcagaaatattccagaagatttccaat
tatggcctcctctttgtaggaagacaaatacctagggagggctgggaaagacctccctcc
tcctgtcagcacccctcccgctcctccagcacagactacattttgtga

DBGET integrated database retrieval system