KEGG   Enhydra lutris kenyoni (northern sea otter): 111159742
Entry
111159742         CDS       T05871                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 3 isoform X1
  KO
K03159  lymphotoxin beta receptor TNFR superfamily member 3
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04064  NF-kappa B signaling pathway
elk04066  HIF-1 signaling pathway
elk04672  Intestinal immune network for IgA production
elk05166  Human T-cell leukemia virus 1 infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111159742
   04066 HIF-1 signaling pathway
    111159742
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111159742
   04061 Viral protein interaction with cytokine and cytokine receptor
    111159742
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    111159742
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111159742
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111159742
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111159742
Cytokine receptors [BR:elk04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   111159742
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 111159742
NCBI-ProteinID: XP_022378030
UniProt: A0A2Y9L990
LinkDB
Position
Unknown
AA seq 420 aa
MRLPWAASPCGLAWGPLILGLCGLLAASQARLEPPYHTENRTCWDREKEYYEPKHQVCCS
RCPPGTHVSVECSPSQDTVCVQCPENSYNEHWNHLSFCQLCRPCDQMLGFEETMPCTSRQ
KTQCRCQPGMFCAHWDTECVHCEPLSDCPPGTEAKPTDEVGVVNRNCVPCKAGHFQNTSS
PRARCQPHTRCEEQGLVEAVPGTARSDASCRNPPEHTEMPGTMMVLAILLPLASFLLLTT
VLACTWKSHPSLCRKLGSLLKRRPEGEESNTADGSWEPPRVNPHFPDLVKPLLPFGDIAP
ASASLPAPPALEEEMLQQQSPLGQARELEPELPEQSQVAHGTSGIHVTGGSVTVTGNIYI
YNGPVLGGARGPGDPPASPEPPYPTPEEGAPGPPGLSTPYQEDGKAWHLAETETLGCHAL
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgcgcctgccatgggccgcctccccctgcggcctggcctgggggcctctcatcctgggc
ctctgcggtctcctggcagcatcccaggcccgactggagcccccataccacacagagaac
cgaacgtgctgggaccgggaaaaggagtactacgaacccaagcatcaggtctgctgctcc
cgctgccccccaggcacacacgtctccgtggaatgcagccccagccaggacaccgtttgt
gtccagtgtcccgaaaattcctacaacgagcactggaaccatctctccttctgccagctg
tgccgcccctgtgaccagatgctgggcttcgaggagaccatgccttgcaccagcagacag
aagacccagtgccgctgccaaccaggaatgttctgcgcgcactgggacacggagtgtgta
cactgtgagccactctccgactgcccaccaggcactgaggccaagccgacagatgaagtc
ggggtagttaacagaaactgtgtgccctgtaaggcaggccacttccagaacacctcctcc
cccagggcccgctgccagccccatacaaggtgtgaggagcagggcctggtggaggcagtt
ccaggcactgcccggtctgacgccagctgcagaaatcccccagagcacacggagatgcca
ggaactatgatggtgctggccatcctgctgccactggcctcattcctgctcctcaccacc
gtcctggcctgcacctggaagagccacccctctctctgcaggaagctaggatctctgctg
aagaggcgtccagagggagaggaatcaaataccgctgatggaagctgggagcctccaagg
gtcaacccacatttccctgacctggtaaagccacttctgccctttggagacatagccccc
gcctcggccagtctcccagcacccccagctttggaggaagagatgctacagcaacagagt
cctctcggccaggccagggagctggagccggagctcccagagcaaagccaggtggcccat
ggtaccagcggcattcatgtcaccggtgggtctgtgactgtcaccggcaacatctacatc
tacaatgggccggtcctggggggagcacggggccccggagacccccctgcttccccagag
cctccatatcccacccctgaagagggtgcccctggccctcctggactctccacaccctac
caggaggatggcaaagcttggcatctggctgaaacagagacactgggctgccacgccctc
taa

DBGET integrated database retrieval system