KEGG   Esox lucius (northern pike): 105018889Help
Entry
105018889         CDS       T04894                                 

Gene name
ctnnb1
Definition
(RefSeq) catenin beta-1 isoform X1
  KO
K02105  catenin beta 1
Organism
els  Esox lucius (northern pike)
Pathway
els04310  Wnt signaling pathway
els04510  Focal adhesion
els04520  Adherens junction
els04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105018889 (ctnnb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105018889 (ctnnb1)
   04520 Adherens junction
    105018889 (ctnnb1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105018889 (ctnnb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 Atx10homo_assoc Queuosine_synth
Motif
Other DBs
NCBI-GeneID: 105018889
NCBI-ProteinID: XP_010882985
LinkDB All DBs
AA seq 790 aa AA seqDB search
MASQSDLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDNQ
VLYEWEHGFNQSFTNDQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDGAHPTN
VQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKK
EASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALV
KMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCL
QILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAG
GMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQTTLAEVDVMQEGMEGLLGTLVQLLGS
DDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHL
TSRHQDAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQG
AIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIR
GLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGV
ATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMTWNETGDLGLDIGAQGEPLGYRQ
EDPSYRSFHSGGYGQDSMGMDSMMDHDMGAHHPGPEYPVDGLPDLGHAQDLIDGLPPGDS
NQLAWFDTDL
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atggcttcccagtctgatctgatggagctcgacatggccatggagccagatcgtaaggct
gccgtgagccactggcagcagcagtcctacctggactctggtatccactcaggggccacc
accactgctccttccctgagtggcaagggcaacccggaggaggaggacgtggacaaccag
gtgctctacgagtgggaacatggcttcaaccagtccttcacaaatgaccaggtggcagat
attgacgggcagtatgccatgaccagagcccagagggtgcgtgctgccatgttcccggag
accctggatgagggcatgcagatcccttccacccagtttgacggcgcccaccccaccaac
gtgcagcggctggctgagccctctcagatgctgaagcacgccgtggtgaacctcatcaac
taccaggatgatgctgagctggccacacgcgccatccccgagctgaccaaactactcaac
gatgaggaccaggtggttgtgaacaaggccgcggtgatggtccaccagttgtctaagaag
gaggccagccgccacgccataatgcgctccccccagatggtgtcggccatcgtgcgcacc
atgcagaacaccaacgatgtggagacggcccgctgcacggccggcacgctgcacaacctt
tcccatcacagggagggcctgctggccatcttcaagtccgggggcatccctgccctggtc
aaaatgcttggctcccctgtggactctgtgctgttctatgccatcaccaccctacacaac
ctgctgctccaccaggagggggccaagatggctgtgcgcctggctgggggcctgcagaaa
atggtggccttgctcaacaagacaaatgtcaaattccttgccatcacaacagattgcctt
cagatcctggcctacggcaaccaagaaagcaaactcatcattctggccagcggaggcccc
caggccctggtgaacatcatgaggacctacacgtatgagaagctgctctggaccaccagc
agagtgctcaaagtgctctccgtctgttccagcaacaagcccgccattgttgaagccggt
ggcatgcaggcccttgggcttcacctcacagaccccagtcagaggctggtccagaactgt
ctgtggaccctcaggaacctatcagatgctgccaccaagcagacgaccttagctgaagta
gatgtgatgcaggagggcatggagggtctgctgggcaccctggtccagctcctgggctcc
gatgacatcaacgtggtgacgtgtgccgctggcatcctgtccaacctcacatgcaacaac
tacaagaacaagatgatggtgtgccaggttggggggatcgaagctctggtccgcacagtg
ttgcgtgccggcgaccgcgaggacatcacagagcccgcgatctgtgccctgcgtcacctt
accagtcgccaccaggatgctgagatggcccagaatgcagtgcgacttcattacggcctg
ccggtggtggtcaagctgctgcaccccccctctcactggccccttatcaaggccaccgtg
ggactgatccgtaacctggccctgtgcccggcaaaccacgcccctctgcgggagcaggga
gccatccccagactggtgcagctgctggtcagagcccaccaggacacccagagacgtacc
tccatggggggcactcagcagcagtttgtggagggagttcgcatggaggagattgtggag
ggctgcactggagctctgcacatcctggcccgagatgtccacaacagaatcgtcatcagg
ggactcaacaccattccacttttcgtccagctgctgtactctcccattgagaacatccag
cgtgtggctgcaggagtcctgtgtgagctggcccaggacaaggaggcggctgaggccatt
gaggcggagggagctaccgccccgctaacagagctgctgcactccaggaatgagggagtg
gccacctatgctgctgcagtgctgttccgtatgtcagaggacaagccccaggactacaag
aagcgcctgtctgtggagctcaccagctccctgttcaggacagagcccatgacctggaat
gagactggcgatctgggcctggacattggcgctcaaggagaacccctcggctaccgccag
gaagaccccagctaccgctccttccactccggaggatatgggcaggactccatgggcatg
gactccatgatggaccatgacatgggtgcccaccaccccggacccgaatacccagtcgac
ggactgcctgacctgggccacgctcaagacctgatcgatgggctgcccccaggcgacagc
aatcagttggcttggtttgatactgacctgtaa

DBGET integrated database retrieval system