KEGG   Esox lucius (northern pike): 105024622
Entry
105024622         CDS       T04894                                 

Definition
(RefSeq) erythropoietin-like
  KO
K05437  erythropoietin
Organism
els  Esox lucius (northern pike)
Pathway
els04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    105024622
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:els04052]
    105024622
Cytokines and growth factors [BR:els04052]
 Cytokines
  CSF and other factors
   105024622
SSDB
Motif
Pfam: EPO_TPO DUF4862 Y_phosphatase
Other DBs
NCBI-GeneID: 105024622
NCBI-ProteinID: XP_010892971
LinkDB
AA seq 172 aa
MVLQWAGQGIPSPVRPICDLRVLDHFIMEARDTETALRGCKAGCGVTGTFVVPLTNVDFL
VWETKDIWEQAVEVQSGLSLLGQALGAVGESLSNAVMQSLITNNKSNIRSLGQVLHSLHI
KGVSIHAAPAGGGTATRKVSSLSELLSVHINFLRGKVRLLLKNAPVCQQSSP
NT seq 519 nt   +upstreamnt  +downstreamnt
atggtactccagtgggcaggacagggcatcccttcacctgtcaggcccatctgtgacctc
cgggttctggaccacttcatcatggaggcccgcgacacagagacggctctgcgaggttgc
aaggcgggatgtggcgtgacaggcacgtttgtggttcctctgacaaacgttgacttttta
gtctgggagacaaaggatatttgggagcaggctgtggaagtccagtcagggctgtctctg
ttaggccaggctctgggcgctgtgggggagtcattgagcaacgctgtcatgcagagcctc
atcaccaacaacaagagcaacatccggagcctgggccaagtgctgcatagccttcacatc
aagggcgtgtccattcatgcagccccagctggaggtggcacagcaaccaggaaggtgtca
tccctatctgaactgcttagtgtacacatcaacttcctacgaggaaaagttcgcctgctt
ctcaaaaatgctcccgtctgtcagcagagcagtccgtga

DBGET integrated database retrieval system