KEGG   Escherichia coli UM146: UM146_06335
Entry
UM146_06335       CDS       T02000                                 

Definition
(GenBank) galactitol-1-phosphate dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
elu  Escherichia coli UM146
Pathway
elu00052  Galactose metabolism
elu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    UM146_06335
Enzymes [BR:elu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     UM146_06335
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C ADH_zinc_N_2 Shikimate_DH 2-Hacid_dh_C 3HCDH_N UDPG_MGDP_dh_N Methyltransf_25 PrmA ELFV_dehydrog TrkA_N MTS ThiF
Other DBs
NCBI-ProteinID: ADN70668
LinkDB
Structure
PDB: 
4UEJ 4A2C 4UEK 4UEO

Position
1328691..1329731
AA seq 346 aa
MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHE
FSGYIDAVGSGVDDLHPGDVVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGLAEY
IVVKRKNVFALPTDMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCA
VALGAKSVTAIDISSEKLALAKSFGAMQTFNSLEMSAPQMQGVLRELRFNQLILETAGVP
QTVELAVEIAGPHAQLALVGTLHQDLHLTSTTFGKILRKELTVIGSWMNYSSPWPGQEWE
TASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtgaatgatactgatggtatcgtgcgcgttgcagaaagcgtcattcct
gaaattaaacatcaggatgaggtgcgggtaaaaattgccagctcgggcttatgtggttcc
gatttacccaggatatttaaaaatggtgcacattattatccaataacgttaggtcatgaa
tttagcggctatattgatgcggtgggatccggtgttgatgatttacaccctggcgatgtg
gttgcctgtgtgccgttattaccctgttttacttgtccagagtgtttgaaagggttttat
tcccagtgcgcaaaatatgattttattggctcgcggcgtgatggtggacttgctgaatat
attgtcgttaagcgaaaaaatgtctttgctctacccacggatatgcctattgaggatggg
gcttttattgagccgattaccgttggcctgcatgcttttcatttagcgcaaggttgtgag
aataaaaacgttattattattggtgccggaaccattggcctgctggctattcagtgcgct
gtcgcgctgggagcaaagagtgtgacggctatcgacattagctcagaaaaactggcactg
gcaaaatctttcggtgcgatgcaaacatttaacagccttgaaatgagcgcgccgcaaatg
cagggcgttttacgcgagctgcgctttaatcagcttatcctcgagacggctggcgtcccg
caaactgtcgaactggcggtagagattgccgggcctcatgcccagctggcgctggtgggc
acgttgcatcaggatctgcatttaacatcgacaacgtttggcaaaatattacgtaaagag
ctgacggttatcggcagttggatgaactactccagcccttggccggggcaggagtgggaa
acggcgagccggttgctgacagaacgtaagttaagcctggagccattaatcgctcaccgt
ggaagctttgaaagcttcgcccaggcggtgcgtgacatcgctcgtaatgctatgccgggc
aaagtgttgctcattccctga

DBGET integrated database retrieval system