KEGG   Enterobacter sp. R4-368: H650_13650Help
Entry
H650_13650        CDS       T02700                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
enr  Enterobacter sp. R4-368
Pathway
enr00250  Alanine, aspartate and glutamate metabolism
enr00410  beta-Alanine metabolism
enr00640  Propanoate metabolism
enr00650  Butanoate metabolism
enr01100  Metabolic pathways
enr01120  Microbial metabolism in diverse environments
Module
enr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:enr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    H650_13650
   00650 Butanoate metabolism
    H650_13650
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    H650_13650
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    H650_13650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:enr01007]
    H650_13650
Enzymes [BR:enr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     H650_13650
Amino acid related enzymes [BR:enr01007]
 Aminotransferase (transaminase)
  Class III
   H650_13650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGN86130
UniProt: R9VRV5
LinkDB All DBs
Position
complement(2684678..2685943)
Genome map
AA seq 421 aa AA seqDB search
MKNNELNQRRLQATPRGIGVMCGFYAAKAENATLWDVEGNEVIDFAAGIAVLNTGHRHPK
VMAAVEKQLQAFTHTAYQIVPYESYVSLAERINERVPVAGPAKTAFFSTGAEAVENAVKI
ARAYTKRPGIITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSIYHAQYPNALHGVSTD
EALKSLERIFKADIAPDQVAAILLEPVQGEGGFNVAPNDFMQALRKLCDSHGILLIVDEV
QSGFARTGKLFASEYYDVKPDLITMAKSLAGGLPLSAVAGRAEVMDAPAPGGLGGTYAGN
PLAIAAAHAVLDVIEEENLCERANHLGQHLVEVLNRAKAQCPYIADIRAQGSMVAVEFND
PQTGAPSAEFTKQVQEKALADGLLLLSCGVYGNVIRFLYPLTIPEVQFRKALDILSQSLT
D
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaacaatgaattgaatcagcgccgtttacaggcgacgccgcgtggcatcggggtc
atgtgcggtttttacgccgcaaaagcggaaaacgcgacgctgtgggatgtggaagggaac
gaagtgatcgactttgccgccgggattgcggtgcttaacaccgggcatcgccatccaaaa
gtgatggcggcggtggaaaaacagttacaggcatttacgcataccgcttaccagattgtt
ccttacgaaagctatgtctcgctggcagaacgtattaacgaacgcgtgccggttgctggc
ccggcgaaaacggcgtttttctcgactggcgccgaagcggtggaaaacgcggttaaaatt
gcccgcgcctataccaaacgccccggaattattacctttggcggcggtttccacggtcgc
actttcatgaccatggcactcactggcaaagtcgcgccgtataaaattggcttcggccca
ttccccggttcgatttaccacgcccagtatcccaacgcgctgcacggtgtgagcactgac
gaggcgctgaaaagcctggaacgtatttttaaagcggatatcgcgccggatcaggtggcc
gccattctgctggaacccgtacaaggcgagggcggttttaacgtcgcaccgaatgatttt
atgcaggcgctgcgcaagttgtgcgatagccacggtattctgctgatcgttgacgaagtg
cagagcggttttgcccgcactggcaagctctttgccagcgaatattacgatgtgaaaccc
gatttaatcaccatggcgaaaagtctggccggtggcttgccgctttcggcggtggccggg
cgtgctgaggtgatggatgcacctgcgccgggtggtttgggcggcacttatgcgggcaat
ccgctcgctatcgcggcggcacatgcggtgctggacgtgattgaagaagaaaatctttgc
gaacgggcgaaccatctgggtcagcatctggtggaagtactgaaccgcgcaaaagcgcaa
tgcccctatatcgctgatatccgtgcacagggctcgatggtcgcggtggaatttaacgat
ccgcaaaccggcgcgccatcggctgaatttactaaacaggtgcaggaaaaagcgctggcg
gacgggctgttgctactgagctgcggggtttacggtaacgttattcgcttcctctacccg
ttaaccattccggaagttcagttccgcaaggcgctggatattctctcccagtcgctgacg
gattaa

DBGET integrated database retrieval system