KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_2812Help
Entry
ECO103_2812       CDS       T01096                                 

Definition
(GenBank) conserved predicted protein
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LPD38 LPD5 LPD1 MuF_C Arm-DNA-bind_4
Motif
Other DBs
NCBI-ProteinID: BAI31579
LinkDB All DBs
Position
complement(2861853..2870207)
Genome map
AA seq 2784 aa AA seqDB search
MAYSEEQRPEAQLGNQNRNSLNIQQPGETDSYEAFFSDSNRWKDNSTSFSLGDVLPTMGK
GFARSVRGTGEMARGLGDAMIQSPVKTGARILNEFSRMGLPGVATVQDIFAGGSRGADEV
IDTLPDGKNAVTDTVGKGLKVTGKAVSDGAKSSDEWLTSKMSPGALRALNTPMTEGYDDS
AVWVAKGVNLIGALVPDMVAGGVAKKVGDVTLRKTLTAGLEKKYIAAGMQPERATALAAE
AVDKKMPDLFQAGLITHSTASAQGQSAMAAADAVLNADYSELAQSPKFQQTFLSIDADPQ
HAQLTDRQKMDLAKERVADEVRAQLATDPELLAVNAMAAKLGDAQLLNLAMRGTANTVKS
GIVRNATEQGTINAAQGGYSRYQENTALRETAGMDVSPWEGVADATIEGAALGAAMGAPF
GAAAGYRGKRQAADEAAMREAESVPQDESAPQPEPVDPVAQHRESMQGMNREQLLEQYAD
ADMAHEGDTSAVHRREAASQLLNELDEQAKRQAVMDELKAKPRHELLEEYRKLSQKEGRT
DTEEQQLQAIRDVLRPQREARPEAQPQPENADDGDGSIYPTVRFRDPDEVRIEINESGAS
RPAERIEKVRPDNRYFTDEKSALGSDVFRNASATGLKPSVVKKGENQYAVEMDNPAFSED
VATETINTLADGERITDADPMEQPAFMRDPRFRGFTGDDTEVQARLARGNAPTAEELVRS
QMAEGDAGPTAQELTERPRLPAPGDIHPGQGYPLPGEVARTPDENQAGRGGRFTTTGEVK
GQSFQKGRAQAPENAAGRQGEILEGETVRRGLPSPDEQNATAPVREGLPAPESQRGVDMP
QPESLPRMVRDSLPELAQQAEARRQTGDNRQTITDVPDTEVPVPVDKPSTHQQARGAKIE
DFGEEIKGAAKHRYAQLAEAMGKTLEDGEYATQPLSKLFPKPDYARLEKEGVDSDTLAMM
ALYRSEIPTRTSRNMQKWISIVKSGREATAGMLEGKIPAAKLADMMDSKPGLRSMSDTWK
LLRTLSALQIDKASGYRVRSGVYSFVGGKRYDPPQMMYSLRDSKGRDLFFSESRDELLKK
AKAYFDEQGSRERETPATSADDRITFDVYRHKASGDIFIGYGKNRQKLKGGFESARDAHD
YVRTHRDELVNQVKALREVSREEQRNATNRDRTGPERRKGDVSPEQFSDAFGFRGVQFGN
YVESPRRQADLNRAYDSLHDLADVLNVPTKALSLNGRLGLAFGARGKGKAAAHYEPGEVA
INLTKGNGPGALAHEWFHSLDNYFGRYDVSTDGKITSGGDYMTEAQRAGRVFKDGRYVDA
EYPVRQEVYDAFKGVMKAINSSDMLRRSERLDGVRSKPYWSTDVEMAARAFERYVQDKAR
MAGVENDYLVNIRKADDHGQPDTYAYPTNAELDGGIREAFDHLFRTLKTRETDKGVAFYS
RKGVTRTPEGNLISDVNRSAEAKGSPVPQVEAVARGVMSGIKDSDLKVRVVKSQKEAEAL
AGELFDGYGRVHAFYRPDKREIVLVADNIPDGRTVREKLRHEIIHHAMEHVVTPAEYQTI
IKTVLKTRDSDNVTIREAWRKVDASYGKESPEVQAGEFLAHMAEKQPNKFVAAWERVVAL
VKGVLRRTGLLKPTELNDIRLVRETIRTLGLRVREGYTPREDGAGASSQYSRSGKPDPFK
VPEGEGERYRDDLARMMKSLRSGAMTANIGRTPPVLRHLGAPDLPLVISRDTVRKATNGV
KHVVPMDVIERLPELMHDPDAIYRSATERNAVVMLLDAVDKNGDPVVSAVHMKATDKRIE
INKVASVYGTKGGMNKANSLDKAGLTLYRKEKLSRDNPQYSGLQLPKEERSYRGSVDKIL
YPEDIRNGPYYSRTSSLTPEETIASRFVRQMQDKFQVLKAVQENIRKTGGKIDDSNNAYM
AEELFHGKAENDLNVMKERYVQPLAKLLADYKIAQADLDEYLYARHAPERNAHIAKINPK
MPDGGSGMTNAEAAEIMQRVRNSGKQAQYDRLAGIIDDMLARRRELIRQAGLEENGVVDA
WQNAYRYYVPLKGQDVDGVVSLPRTGKGFTIGGRESRQAMGRASRAQSPSTQAIQDLSES
LIRHRKNEVGNAFLKLVQDNPDKDYWQVFTDDRPDTMRTIAERKDQETGETIREAVERPV
PMAMMADRYFTTKKNGKTYYIKLHDPRLMRAMKNMGPETSNAVIRTLGKVNRFLATVNTS
YNPEFLVSNFIRDVQTAVMNLKAEQGRSDGKLKGLDNLSALAVVKDSRSAMSAVYASLRG
KTLTGKGAQWQKVWKEFVEDGGKTGWFNMGDLEGQQKEMDRLVSLAKGGWKGQSIGAWNS
FLNLVEDANGAVENALRLSAYKHARDTGLSRQQAASLAKNMTVNFNRRGEQGALMNSLYM
FANASIQGTANLVRTLGHLNGEGPLLERLRWKNLNVPQKIALAAVGAGYLLGSLNRSVAG
EDDDGVNWYDKVPSHVKERNLVIMKSVFGGKAGEYWSIPLPYGYNVFFLLGHTAEGVAAG
DLTASRAAGNVVGGVLGAFSPIGSETSETLSGALLKNAAPTILRPFANLAMNENFMGAQI
YQENMPFGTPKPDSQLGRRSTPEAYKAFASWLNAFSGGSQYRPGAVDITPESLKYWVDYI
SGGTGRFISKTTDAAVKSLNGIDIPEQQVPFLGKISGEVMPYADQQKMYDRMTEVAQYHA
ELKSLTGAERTAFIDENNGKLSMNGLMQDTRKRLKDLRKQRDAIYADSTLSLAQQSAMVK
SVERDMKIAVDRFNREYNKKVGVE
NT seq 8355 nt NT seq  +upstreamnt  +downstreamnt
atggcctattcagaggaacagcgtcctgaggcgcaactcggtaaccagaatcgtaacagc
ctgaacattcagcaacccggcgaaactgacagctatgaagcatttttctctgattcaaat
cgctggaaggataacagtacgtcgttcagcctgggcgatgtattgccaacaatgggtaaa
ggtttcgcccggtccgtccggggaacaggggaaatggcccgtggactcggtgatgcgatg
attcagagcccggtaaaaacaggggcgcgtattttaaatgagttcagccgtatggggctg
ccgggtgtcgcaactgtgcaggatatttttgccggtggcagcaggggggctgatgaggtc
atcgataccctgcctgatggcaaaaacgcggttacagatactgtcggtaaaggtctgaag
gtcaccggtaaggctgtcagtgacggcgctaaatcctcggatgaatggctgaccagtaag
atgtctccgggtgctctgcgtgcgctgaatacgccgatgaccgaaggctatgatgattct
gcggtctgggtggcgaagggcgtaaacctgattggtgcccttgtacctgatatggttgct
ggcggtgtggctaaaaaggtgggtgatgtcacattgcgaaaaacgctgaccgccgggctg
gagaaaaaatacatcgcggcagggatgcagccggaaagagccacggcactggcagcagaa
gctgtcgataaaaaaatgccggatttattccaggcgggcctgatcacccattccacagcc
agtgcacaggggcagagtgcaatggcggcagcagatgctgttcttaatgcggattactct
gagctggcgcagtcaccgaaatttcagcagacgtttttgtccattgacgccgatccgcag
cacgcacagcttactgatcgccagaaaatggatctggcaaaagagcgtgttgccgatgag
gtgcgcgcgcagctggcaacagatcctgaattgctggctgtgaatgccatggcggcaaaa
ctgggcgatgctcagttgcttaatctggcgatgcggggcacggcgaataccgttaaaagc
ggcattgtcagaaatgccacggaacaggggacgattaatgcggcgcagggtggctattca
cgctatcaggaaaacacggcattgcgtgagaccgccggaatggatgtgtcaccgtgggag
ggcgtggctgacgcaacgatcgaaggtgcagcccttggtgctgcaatgggggcaccattc
ggtgcggctgccggatatcgtggaaaacgtcaggcggcagatgaagcagccatgcgtgag
gctgaaagcgttcctcaggacgaatcggctccgcaacccgaaccggttgatccggtggca
cagcatcgtgaatctatgcaggggatgaatcgcgagcagcttctggaacagtatgctgat
gcggatatggcacatgagggagacacgtctgccgttcatcgccgggaagccgccagccag
ctgttgaatgaactggatgaacaggcgaagcgacaggcggtgatggatgagctgaaggcg
aagccgcgccatgaactgcttgaggaataccgaaaactcagccagaaggaagggcgtact
gatactgaagagcagcagttacaggcaatacgtgatgtgcttcgccctcagcgggaggcc
agaccggaggcacagccacagccggaaaatgcggatgatggcgacgggagtatttacccg
acggtgcggttccgcgatccggatgaagttcgtattgaaattaacgagagtggtgcgtcc
agaccagcagaacgcattgaaaaggtgcgtccggacaaccgttatttcacggatgaaaaa
agtgctctggggagcgacgttttccgcaatgccagcgccaccggcctgaaaccgtccgta
gtgaagaaaggcgagaatcagtatgccgttgaaatggataatcctgcgttctctgaagat
gtggcaacggagaccattaacactctggctgacggagagcgtattactgatgctgatccg
atggaacagcccgcgttcatgcgtgacccgcgattccgtggttttacgggggatgataca
gaagtgcaggcccgtcttgctcgtggcaacgcgccgacggcggaagaactggtgcgttcc
cagatggctgaaggtgatgccggtccgacagcacaggagttaactgagcgtccacgcctt
cccgctcccggcgatattcatcccggacagggatatccgttaccaggagaagtagcgcgt
acgccggatgaaaatcaggccggacgtggtggtcgttttaccacaaccggtgaggtgaag
ggccagagtttccagaaaggacgtgcgcaggcaccggaaaatgccgctggtcgccagggg
gaaatactggagggcgaaacagttcgtcgtggtctgccgtcaccggatgagcagaacgcc
acagcaccagtgcgtgaaggtcttcctgcacctgaaagtcagcgtggggttgatatgcca
cagcctgaatcactccctcgtatggttcgtgactcccttccggaactggcacagcaggca
gaagcacgcagacagaccggggataatcgccagaccataaccgatgttccggatactgag
gtgccggtgccggtagataaaccgagcactcaccagcaggcgcgtggtgcgaaaattgaa
gactttggcgaggagattaagggcgcggcaaaacaccgttatgcgcagcttgctgaagct
atgggtaaaacgctggaggatggggagtacgcgacacaaccactgagcaaactgtttcca
aagccggattatgcccgtctggaaaaagaaggtgtggatagtgacacgctggcaatgatg
gcgttgtatcgcagtgaaattcccaccagaacaagccgtaacatgcagaaatggatcagc
attgttaaaagcggtcgcgaagctactgccggtatgctggaggggaaaattccggcagcg
aaactggctgatatgatggacagtaagccggggttacggagcatgtcggatacctggaaa
ctgctccgtacgctttctgcattgcagattgataaagcatccggctatcgtgtcaggtcc
ggtgtttattcgtttgtcgggggaaaacgttacgatccgccgcaaatgatgtattcgctt
cgtgatagcaaggggcgcgacctctttttctcggaaagccgggatgagttactgaaaaag
gcgaaagcatatttcgatgaacaaggctccagagaaagggaaacgccagcaacctctgct
gatgacagaataacctttgacgtgtaccggcataaggccagtggcgacatttttatcggt
tatggcaaaaacaggcagaaactgaagggcggttttgagtctgcccgtgatgcacatgat
tatgtgcgcacacatcgtgatgagctggttaatcaggtgaaggcgctgcgtgaagtctcg
cgtgaggagcagcgtaacgccaccaaccgcgatcgtaccggaccagaacgccgcaagggg
gatgtttcgccggagcagttcagtgatgcgtttggttttcgtggtgtgcagtttggtaat
tatgtggaaagtccgcgtcgtcaggctgatttgaaccgggcttatgactcgctgcatgac
ctggctgacgtgctgaacgtgccgacaaaagcgctttctctgaacggtcgtcttgggctt
gcttttggtgcccgtggtaagggtaaggcggcggcacactatgagccgggtgaggtggca
atcaacctgacaaaaggtaacggaccgggggcgctggcccacgaatggttccattcactg
gataattattttggtcgttatgatgtttccactgacgggaagatcacgtcaggtggcgac
tatatgacggaagcacagcgtgccgggcgcgtatttaaagacggcaggtatgttgatgcg
gaatatccggtacgtcaggaggtttacgacgcgtttaaaggcgtgatgaaagccattaac
agcagtgacatgttgcgtcgttctgaacgcctggatggcgttcgttcaaaaccgtactgg
tcaacggatgttgaaatggcggcgcgagcctttgagcgttatgttcaggataaagcgcgt
atggctggcgtggagaatgattatctggtcaatatccgtaaggcggatgaccatggacag
ccggacacctacgcttatccgacgaatgcagaactggatggcggtattcgtgaggcattc
gatcacttgttccgaacactgaaaacccgtgagacggacaagggagttgcgttttattcc
cgtaagggcgtgacccgcacacctgaaggcaatctgatttcggatgttaaccgcagtgcg
gaagccaaaggcagtccggtcccgcaggttgaagcggttgcccgtggcgtgatgagcggc
attaaggacagtgacctgaaggtccgtgtggtgaagtcacagaaagaggctgaagcgctg
gcgggtgaattgttcgatggttacggcagggtgcacgcattctatcgtccggataaacga
gaaattgtcctggtggcggataacatccctgacgggcggaccgttcgcgagaagctgcgt
cacgagatcattcaccatgccatggagcatgttgtcacaccagcggaatatcagacgatt
atcaaaaccgtgctgaaaacccgcgacagtgataacgtcaccatccgtgaagcctggcgt
aaggttgatgcttcctatggtaaggaatcaccggaagtacaggcgggtgaatttctggca
catatggcggagaaacagccgaataaattcgtggcggcatgggagcgtgttgttgccctg
gtcaaaggggtactgcgtcgtacggggttactgaagccgacggaactgaacgatatcaga
cttgttcgcgaaactattcgcacgttaggcctgcgtgtgcgggaaggttacacgccgcgt
gaggatggcgcgggcgcatcgtctcagtactcccgtagtggtaaacctgatccgttcaaa
gtgccggaaggtgagggcgagcgttatcgtgatgaccttgccagaatgatgaagtcgtta
cgttctggtgcaatgactgcaaacatcgggcgtacgccgccggtattgcgccaccttggc
gcaccagatttgccgctggttatctcccgcgacactgtgcggaaggcaaccaatggagtg
aaacatgtggtgccaatggatgttatcgagagacttcctgagctgatgcacgatccggat
gcaatttaccgttccgcgacagaaagaaatgcggttgtgatgctgcttgatgccgtggat
aaaaatggtgatccggtggtgtcggcagtgcacatgaaggcaacagataaacgaatagaa
attaacaaggtggcttctgtatatggaacaaaaggggggatgaacaaagctaatagcctg
gataaagcaggtttgacgctttaccggaaggaaaaattaagccgcgataaccctcagtac
agtgggcttcaattgcccaaagaggagcgttcttatcgcggctctgtagataaaatactc
tatcctgaagatattcgcaatgggccgtattactcccgtaccagcagtctgacaccggaa
gagacaattgcatcgcgttttgtgcgtcagatgcaggataaattccaggtgctgaaagct
gttcaggagaacatccgtaaaactggcggaaaaatagacgacagtaacaacgcttatatg
gcggaagaactcttccacgggaaggcggaaaacgacctgaacgtgatgaaggagcgctac
gttcagccactggctaaattactggcggactacaaaattgcgcaggccgatctggatgag
tacctctacgcccgtcacgcgccggaacgtaacgcgcatatcgcgaaaatcaacccgaaa
atgccggacggcggttcggggatgaccaacgcggaagcggcggaaatcatgcagcgtgta
cgtaacagtggcaaacaggcacagtatgaccgtctggcagggattattgacgatatgctg
gcccgtcgccgtgagcttatccgtcaggccggacttgaagagaacggtgtggtggatgcc
tggcagaacgcctaccgttactacgttcccctgaaaggtcaggatgttgacggtgtggtg
tcactgccccgtacaggtaagggcttcaccatcggcggacgtgaaagcaggcaggccatg
gggcgtgcatcccgggcacagtctccgtccactcaggcgatacaggacctgagcgaatcg
ctgatccgccatcgcaaaaacgaagtgggtaacgccttcctgaaactggtgcaggataat
cccgacaaggattactggcaggtattcaccgatgacagaccggataccatgcggacgatt
gcagagcgcaaggaccaggaaactggtgaaaccattcgcgaagctgtcgaacgccctgta
ccgatggcaatgatggcagaccggtacttcaccaccaaaaagaacggcaaaacgtactac
atcaaactccatgatccgcgcctgatgcgtgcgatgaagaatatgggaccggaaaccagt
aacgccgtaatccgcacgctggggaaagttaaccgcttcctggcaacggtgaacacgtcg
tataacccggaattcctggtcagtaacttcatccgtgacgtgcagacggcggtgatgaac
ctgaaggcggagcagggaaggagcgacggtaaactgaaagggctggataacttatccgcc
ctggctgtggtgaaagacagccgttctgccatgtcagccgtatacgccagtctgcgtggt
aaaaccctcacgggaaaaggtgcacagtggcagaaggtgtggaaagagtttgttgaggac
ggagggaaaaccggctggtttaacatgggtgaccttgaaggccagcagaaggaaatggat
cgccttgtctcactggcgaaggggggatggaaaggccagagtatcggtgcatggaattcg
ttccttaaccttgtcgaggatgccaacggtgcggttgaaaacgctctgcgtctttctgcc
tataagcacgcccgtgataccggtttgtcacgccagcaggcggcgtctcttgccaaaaac
atgacggtgaactttaaccgtcgtggtgagcagggggcgctgatgaattcgctgtacatg
ttcgccaacgccagcattcagggaacggcaaatctggtgagaacgctcggacatcttaat
ggtgagggacctttactggagcgccttcgctggaagaatctgaatgttccgcagaaaatc
gcgcttgccgctgtgggagcaggttatctgcttggctcgcttaaccgcagcgtggcgggt
gaggatgatgacggggttaactggtatgacaaggtgccgtctcatgtgaaagagcgtaac
ctcgtcattatgaaatcggtgttcgggggcaaggccggagagtactggagtattcctctg
ccttacgggtacaacgttttcttcctgctcgggcatactgctgaaggtgtggcggcgggt
gacctgacggcgtcccgtgctgccggtaatgttgttggtggtgtgcttggtgcattcagc
ccgattggcagtgagacgtcggaaacactgtccggggcattgctgaaaaatgcagcgccg
accattctgcgtccgtttgcgaaccttgccatgaatgaaaacttcatgggggcgcagatt
taccaggagaacatgccgtttggtacaccaaaacctgacagccagctgggaagacgttca
acgccagaagcgtacaaggcgtttgcatcctggctgaatgcgttctctggtggcagccag
taccgtcccggcgcggtggatatcacaccggaatcgctgaaatactgggtggactatatc
tccggagggacagggcgcttcatttccaaaaccacggatgcggcggtgaaatcgctgaat
ggtattgatataccggagcagcaggtgcccttcctggggaaaatttcaggtgaggtgatg
ccgtatgctgaccagcagaagatgtacgaccggatgacagaggttgcgcagtatcacgca
gagctgaagagtctgaccggtgcagaaagaacggcgttcattgacgagaacaacggaaaa
ttgtcgatgaacgggcttatgcaggatacccggaagagactgaaggatttgcgtaaacag
cgtgatgccatttacgccgacagtactctcagtctggcgcaacagtcggcgatggtgaaa
tcggttgagcgggatatgaaaattgccgtggatcggtttaaccgcgagtacaacaaaaaa
gtgggagtggagtaa

DBGET integrated database retrieval system