KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_3600Help
Entry
ECO103_3600       CDS       T01096                                 

Gene name
espF
Definition
(GenBank) T3SS secreted effector EspF
  KO
K12786  LEE-encoded effector EspF
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
eoh05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eoh00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECO103_3600 (espF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EspF
Motif
Other DBs
NCBI-ProteinID: BAI32323
LinkDB All DBs
Position
complement(3678871..3679755)
Genome map
AA seq 294 aa AA seqDB search
MLNGISQAVSTLGRHITSAASRVSSAGLSGFSVSPQAVRLNPIRAQSPFSPGTSNINART
TFNVSSPATSFTPSRPAPPPPTSGQASGASRPLPPIAQALKDHLAAYEKSKSLEASGLKP
SRPAPPPPTSGQASGASRPLPPIAQALKDHLAAYEKSKSLEASGLKPARPAPPPPTSGQV
SGSSRSLPPIAQALKDHLAAYEKSKSLDTSSLKPSRPAPPPPTSGLVSGSSRSLPPIAQA
LKDHLAAYEKSKSLDTSGLKPSRPAPPPPTSGQASEASRPLPPIAQALKDKNRY
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatggaattagtcaagctgtttctacactaggacggcatattactagtgcggca
agccgggtaagctctgcggggttatctggcttttcagtgtcccctcaggctgttcgtctg
aatccgattagggctcaatctcctttttctcccggtacgtcgaatatcaatgcgagaacg
acttttaatgtgagtagcccggcgacttcatttactccctctcgtccggccccaccgccg
ccgacaagtggacaggcttccggggcatcccgccctttaccgcccattgctcaggcacta
aaagatcatttggctgcctatgaaaagtcgaaaagccttgaggcttcaggtcttaagcca
agccgcccggccccaccgccgccgacaagtggacaggcttccggggcatcccgcccttta
ccgcccattgcgcaggcattaaaagatcatttggctgcctatgaaaaatcgaaaagcctt
gaggcttcaggccttaagccggcccgcccggctccaccgccgccgacaagtgggcaggta
tctggatcatcccggtctttaccgcccattgctcaggcattaaaagatcatttagctgcc
tatgaaaagtcgaaaagtcttgatacttcaagccttaagccaagccgcccggcaccgccg
ccgccgacaagcgggttggtatctgggtcatcccggtctttaccgcccattgctcaggcg
ctaaaagatcatttggctgcctatgaaaaatcgaaaagtcttgatacttcaggtcttaag
ccaagccgcccggcaccgccgccaccgacaagtggacaggcatccgaggcatcccggcca
ttaccgcctattgctcaggcattaaaagataaaaaccgatattaa

DBGET integrated database retrieval system