KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_0665Help
Entry
ECO111_0665       CDS       T01097                                 

Gene name
mrdA
Definition
(GenBank) transpeptidase MrdA
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
eoi00550  Peptidoglycan biosynthesis
eoi01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:eoi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECO111_0665 (mrdA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ECO111_0665 (mrdA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eoi01011]
    ECO111_0665 (mrdA)
Enzymes [BR:eoi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ECO111_0665 (mrdA)
Peptidoglycan biosynthesis and degradation proteins [BR:eoi01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   ECO111_0665 (mrdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: BAI34634
UniProt: C8UJV1
LinkDB All DBs
Structure
PDB: 

Position
complement(712570..714471)
Genome map
AA seq 633 aa AA seqDB search
MKLQNSFRDYTAESALFVRRALVAFLGILLLTGVLIANLYNLQIVRFTDYQTRSNENRIK
LVPIAPSRGIIYDRNGIPLALNRTIYQIEMMPEKVDNVQQTLDALRSVVDLTDDDIAAFR
KERARSHRFTSIPVKTNLTEVQVARFAVNQYRFPGVEVKGYKRRYYPYGSALTHVIGYVS
KINDKDVERLNNDGKLANYAATHDIGKLGIERYYEDVLHGQTGYEEVEVNNRGRVIRQLK
EVPPQAGHDIYLTLDLKLQQYIETLLAGSRAAVVVTDPRTGGVLALVSTPSYDPNLFVDG
ISSKDYSALLNDPNTPLVNRATQGVYPPASTVKPYVAVSALSAGVITRNTTLFDPGWWQL
PGSEKRYRDWKKWGHGRLNVTRSLEESADTFFYQVAYDMGIDRLSEWMGKFGYGHYTGID
LAEERSGNMPTREWKQKRFKKPWYQGDTIPVGIGQGYWTATPIQMSKALMILINDGIVKV
PHLLMSTAEDGKQVPWVQPHEPPVGDIHSGYWELAKDGMYGVANRPNGTAHKYFASAPYK
IAAKSGTAQVFGLKANETYNAHKIAERLRDHKLMTAFAPYNNPQVAVAMILENGGAGPAV
GTLMRQILDHIMLGDNNTDLPAENPAVAAAEDH
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacagaactcttttcgcgactatacggcagagtccgcgctgtttgtgcgccgg
gcgctggtcgcctttttggggattttgctgctgaccggcgtgcttatcgccaacctgtat
aatctgcaaattgttcgctttaccgattaccagacccgctctaatgaaaaccgcattaag
ctggtgcctatcgcgcccagccgcggcattatctacgaccgtaacggtatccctctggca
ctcaaccgcactatctaccagatagaaatgatgccggagaaagtcgataacgtgcagcaa
acgctggacgctttgcgcagcgtggttgatctgaccgatgacgatattgctgcattccga
aaagagcgcgcacgttcacaccgtttcacctctattcccgtgaaaactaacctgaccgaa
gtacaagtagctcgctttgccgtcaatcagtaccgttttccgggtgtcgaagttaaaggc
tataaacgtcgttactatccttacggttcggcgttgacccacgtcatcggctatgtgtcg
aaaatcaacgataaagacgtcgaacgcctgaataatgacggcaaactggccaactatgcg
gcaacgcatgatatcggtaagctgggcattgagcgttactatgaagacgtgctgcacggt
cagaccggttatgaagaggttgaagttaacaaccgtgggcgtgttatccgccagttaaaa
gaagtaccaccgcaagccggacacgatatttacctgacgctggatctcaaactccagcaa
tatattgaaacgctgctggcgggtagccgcgcagctgtggtagtcaccgatccgcgtaca
ggtggggtgctggcactggtttccacgcctagttatgacccaaacctgtttgttgacggt
atctccagcaaagattattccgccttgctgaacgacccgaatacaccgctggtgaaccgc
gccacacagggggtttatcctcctgcgtctacagttaaaccctatgtggcggtttcggca
ttaagcgccggggtgatcacgcgcaatacgacgctgtttgacccaggctggtggcaacta
ccagggtcggaaaaacgttatcgtgactggaaaaaatggggccacgggcgtctgaatgtc
acaagatcgctggaagaatctgcggataccttcttctatcaggtggcctacgatatgggg
atcgatcgcctctccgaatggatgggtaaattcggttatggtcattacaccggtatcgac
ctggcggaagaacgttccggcaacatgcctacccgcgaatggaaacagaaacgctttaaa
aaaccgtggtatcagggtgacaccattccggttggtatcggccagggttactggacagcg
accccaatccagatgagtaaggcactgatgatcctgattaatgacggtatcgtgaaggtt
ccgcatttgctgatgagcaccgccgaagacggcaaacaggtgccatgggtacaaccgcat
gaaccgcccgtcggcgatattcattccggttactgggagctggcgaaagacggtatgtac
ggtgttgctaaccgccctaacggtacggcgcataaatactttgccagcgcaccgtacaaa
attgcggcgaaatctggtaccgctcaggtcttcggtctgaaagcgaacgaaacctataat
gcgcacaaaattgccgagcgtttacgtgaccacaaactgatgaccgcctttgcgccatac
aacaatccgcaagtggctgtcgccatgattctggagaacggcggcgcgggtccggcggtt
ggtacgctgatgcgccagatcctcgaccacattatgctgggtgataacaataccgatctg
cctgcggaaaatcctgcggttgccgcagcggaggaccattaa

DBGET integrated database retrieval system