KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_1000
Entry
G2583_1000        CDS       T01190                                 

Gene name
nleD
Definition
(GenBank) hypothetical protein
  KO
K23656  T3SS secreted effector NleD
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eok00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    G2583_1000 (nleD)
SSDB
Motif
Pfam: Peptidase_M91
Other DBs
NCBI-ProteinID: ADD55603
UniProt: D3QNI8
LinkDB
Position
1025624..1026322
AA seq 232 aa
MRPTSLNLVLHQSSTSSSMSDTDIESLVKASSVQWIKNNPQLRFQGTDHNIYQQIEAALD
KIGSTETGRVLLNAIESISRLKSETVVIHLNSSRLGVMAHRDIDAENHRGTGSDFHCNLN
AVEYPCGEGISVVDFHATIVFHELLHVFHNLNGERLKVESSRPESQKYSPLLLEEARTVG
LGAFSEEVLSENKFREEIGMPRRTSYPHDSALIHDDNTVSLGFQQVRLHPLL
NT seq 699 nt   +upstreamnt  +downstreamnt
atgcgccctacgtccctcaacttggtattacatcagtcatcaacgtcgagctcaatgtca
gatacagatatcgagtctcttgtaaaagcatcgagcgttcaatggataaaaaataatccg
caacttcgtttccaggggactgatcataatatatatcagcagattgaagcagcactcgat
aagattggctctacagagacagggcgtgtactcctgaatgctattgaatcaatatcccga
cttaaatcagaaacagtggtaatacacctcaactcttccagactaggagttatggcacat
agagatatagatgctgagaaccatcgggggactggttccgattttcactgtaatctgaat
gcagttgaatatccctgtggggaggggattagcgtggtggactttcatgcgactattgtt
tttcatgagttgctccatgttttccacaatttaaatggggagcgtttgaaagttgagagt
tcccgaccagaatcacaaaaatactctccacttttactcgaagaagccaggactgttggg
ttgggggctttttcagaagaggtgctttcagaaaataaattccgcgaagagattgggatg
ccccgtagaacctcctacccgcacgactcagctcttattcatgatgacaatacagtgagt
ctgggattccaacaggtaagactgcatccattgctttag

DBGET integrated database retrieval system