KEGG   Erwinia pyrifoliae DSM 12163: EPYR_03533Help
Entry
EPYR_03533        CDS       T02121                                 

Gene name
gstA
Definition
(GenBank) putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
epr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:epr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EPYR_03533 (gstA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:epr02000]
    EPYR_03533 (gstA)
Enzymes [BR:epr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     EPYR_03533 (gstA)
Transporters [BR:epr02000]
 Other Transporters
  Pores ion channels [TC:1]
   EPYR_03533 (gstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_N_4 GST_C_2 GST_C_3 Tom37
Motif
Other DBs
NCBI-ProteinID: CAY75913
UniProt: D2T8H6
LinkDB All DBs
Position
complement(3580859..3581527)
Genome map
AA seq 222 aa AA seqDB search
MMMITVHHLNNSRSQRVLWLLEELEVPYQIKRYQRGASMLAPDELKKVHPLGKSPVITDG
NRVVAESGAILEYLEAHYDAEERLKLFDDEEVIQSRYWLHYAEGSLMPLLVMKLIFSRMG
KAPVPWLLRPIGSAFGKGVQKGYIDPQLATHRQFIEQHLTSNEWFAGSRFSIADVQMSFP
IQAITARGGAAGSPAIQAWLEKVQCRAAWQRALDKGGKINLV
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
gtgatgatgatcactgtgcaccatcttaacaattcacgttcgcagcgcgtgctgtggctg
ctggaagagcttgaagtgccgtatcagatcaagcgctatcagcgtggagccagcatgctg
gctcctgacgagctaaaaaaagtgcacccgctgggcaaatccccggtgattaccgatgga
aatcgtgttgtggcggaatccggcgcgatcctggagtacctggaggcgcattatgacgcc
gaagagcggctgaaactttttgacgatgaagaggtaatacaatctcgttattggttgcac
tatgccgaaggttcattaatgccgttgctggtgatgaaactgatctttagccgtatgggt
aaagcgccggtaccctggctgttgcgaccgattggcagtgcgtttggtaaaggcgtgcag
aagggctatatcgacccacaactggccactcatcgccagtttatcgagcagcacctgacc
agcaatgagtggtttgccggtagtcgattcagcattgccgatgtacagatgagctttccg
atacaggcgatcaccgcgcgtggtggtgccgctggcagcccggcgattcaggcctggctg
gaaaaagtgcagtgccgcgcggcctggcagcgcgcgctggataaagggggcaaaattaac
cttgtgtga

DBGET integrated database retrieval system