KEGG   Equus przewalskii (Przewalski's horse): 103551173
Entry
103551173         CDS       T04644                                 

Gene name
NR3C1
Definition
(RefSeq) nuclear receptor subfamily 3 group C member 1
  KO
K05771  glucocorticoid receptor
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103551173 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:epz03000]
    103551173 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:epz03310]
    103551173 (NR3C1)
Transcription factors [BR:epz03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    103551173 (NR3C1)
Nuclear receptors [BR:epz03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   103551173 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 SCA7 Pheromone
Other DBs
NCBI-GeneID: 103551173
NCBI-ProteinID: XP_008518753
LinkDB
Position
Un
AA seq 776 aa
MDCKESLSSPGREEIPSSVLGQERGNVMDFYKTLRGGAPLKLSASSPSLAAASQSDSKQQ
RLLVDFPKGTGSNAPQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLPSGETDF
RLLEESIANLNRSTSVPENPKSSASVAVSAAPTEKEFPKTHSDVSSEQQNLKGQTSTSRG
NVYTTDQRTFDILPDLEFSSGSPSKETNESPWRADLLIDENCLLSPLAGEDDSFLLEGNS
NEDYKPLVLPDAKPKIKDNGDLTLSSPNSVPLPQVKTEKEDFIELCTPGVIKQEKLGPVY
CQASFSGAKIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVGS
ENWNRCQGSGDDNLTSLGTLNFSGRSVFSNGYSSPGMRPDVSSPPSSSSAATGPPPKLCL
VCSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDCIIDKIRRKNCPACRYRKC
LQAGMNLEARKTKKKIKGIQATTGVSPQETSENPANKTIVPATLPQLTPTLVSLLEVIEP
EVLYAGYDSSIPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWM
FLMAFALGWRSYRQSSGSMLCFAPDLIINEQRMTLPCMYDQCKHMLYIASELHRLQVSYE
EYLCMKTLLLLSSVPKEGLKSQDLFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKL
LDSMHDVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK
NT seq 2331 nt   +upstreamnt  +downstreamnt
atggactgcaaggaatcattaagctcccctggcagagaagaaatccccagcagtgtgctt
ggtcaggagagggggaatgtgatggacttctataaaaccctaaggggaggagctcctctg
aagctctcagcgtcttcaccctcactggctgcggcttctcagtcagactccaagcagcag
agacttttggttgattttccaaaaggcacaggaagcaatgcgccacagccagatctgtcc
aaggccgtttcactctcaatgggactgtatatgggagagacagaaacaaaagtgatggga
aatgacttgggattcccacagcagggccaaatcagccttccctctggggaaacagacttt
cggcttctggaagaaagcatcgcaaacctcaataggtcgaccagtgttccagagaacccc
aagagttcagcatccgttgctgtttctgctgcccccacagagaaggagtttccaaaaact
cactctgatgtgtcttcagaacagcaaaatctgaagggccagactagcaccagcagaggc
aatgtgtataccacagaccaaagaacctttgacattttgccggatttggagttttcttct
gggtccccaagtaaagagacgaatgagagtccttggagagcagacctcttgatagatgaa
aactgtctgctttctcctttggcaggagaggatgattcattccttttggaaggaaactcg
aatgaagactataagcctctcgttttaccggatgctaaacctaaaattaaggataatgga
gatctgaccttatcaagccccaacagtgtgccactgccccaagtgaaaacagaaaaagaa
gatttcatcgaactctgcacccctggggtaattaagcaggagaaactgggcccagtttac
tgtcaggcaagcttttctggggcaaagataattggtaataaaatgtctgccatttctgtt
catggtgtgagtacctctgggggacagatgtaccactatgacatgaatacagcatccctt
tctcaacagcaggatcagaagcctattttcaatgtcattccaccaattcctgttggttca
gaaaattggaataggtgccagggatctggagatgacaacttgacttccttggggactctg
aacttctctggccgatcggttttttctaatggctattcaagccctggaatgagaccagat
gtaagctctcctccatccagctcctcagcggcaacgggaccacctccgaaactctgcctt
gtgtgctctgatgaagcttcaggatgtcattatggggtcttgacttgtggaagctgtaaa
gtattcttcaaaagagcagtggaaggtagacagcacaattatctttgtgctggaagaaat
gattgtatcattgataaaattcgaagaaaaaactgcccggcatgccgctatcgaaaatgt
cttcaagctggaatgaacctggaagctcgaaaaacaaagaaaaagataaaaggaattcag
gccactacaggagtctccccacaagaaacttctgaaaatcctgccaacaaaacaatagtt
cctgcaacattaccacaactcacccctactctggtgtcactgttggaggtgattgaaccc
gaagtgctatatgcaggatatgatagctctattccagactccacttggcggatcatgacc
acactcaacatgttaggtgggcggcaagtgattgcagcagtgaaatgggcaaaggcgata
ccaggattcaggaacttacacctggatgaccaaatgaccctactgcaatattcctggatg
ttcctcatggcatttgccctggggtggagatcatacagacaatcaagtggaagcatgctg
tgttttgctcctgatctgattattaatgaacagagaatgactctaccctgcatgtatgac
caatgtaaacatatgctgtatatcgcctctgagttacacaggcttcaggtatcttatgaa
gagtatctctgcatgaaaaccttactgcttctctcttcagttcctaaggaaggtttgaag
agccaagatctgtttgatgaaatcagaatgacctacatcaaagagctaggaaaagccatt
gtcaagagggaaggtaactccagtcagaactggcagcggttttatcaactgacaaaactc
ttggactccatgcatgatgtggttgaaaacctccttaactattgcttccagacatttttg
gataagaccatgagtattgaattcccagagatgttagctgaaatcatcaccaatcagata
ccaaaatattcaaatggaaatatcaaaaaacttctgtttcatcaaaagtga

DBGET integrated database retrieval system