KEGG   Equus przewalskii (Przewalski's horse): 103555394Help
Entry
103555394         CDS       T04644                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00590  Arachidonic acid metabolism
epz01100  Metabolic pathways
epz04611  Platelet activation
epz04726  Serotonergic synapse
epz04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103555394 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103555394 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    103555394 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    103555394 (PTGS1)
Enzymes [BR:epz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103555394 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 103555394
NCBI-ProteinID: XP_008525094
LinkDB All DBs
Position
Un
AA seq 599 aa AA seqDB search
MSRQSLWLRFPLFLLLLPSLVLPADPRAPALVNPCCYYPCQHKGICVRFGLDHYQCDCTR
TGYSGPNCTIPELWTWLRNSLRPSPSFLHFLLTHGRWFWEFVNATFIRDMLMRLVLTVRS
NLIPSPPTYNVAHDYISWESFSNVSYYTRVLPSVPQDCPTPMGTKGKKQLPDAQLLSDRF
LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ
YHLRLFKDGKLKYQMLNGEMYPPTVEQAPVLMHYPRGIPPQNQMAVGQEVFGLLPGLMLY
ATLWLREHNRVCDLLKTEHPTWDDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLKF
DPELLFGVHFQYRNRIAMEFNHLYHWHPLMPDSFRVGSQEYSYKQFLFNTSMLVDYGVEA
LVDAFSRQIAGRIGGGRNLDHHVLHVAVDVIKESRELRLQPFNEYRKRFGMKPYASFQEL
TGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICS
PEYWKPSTFGGEMGFNIVKTATLKKLVCLNTNTCPYVSFRVPKRPQDDGPGVERPSTEL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcagagtctctggctccggttcccgctgttcctgctgctgctgccgtcccta
gtcctgcccgcggaccccagggcgccggcgctagtgaacccctgttgttactacccatgc
cagcacaagggtatctgtgtccgcttcggccttgaccactaccagtgtgactgcacccgc
acgggctactccggccccaactgcaccatccctgagctatggacctggctccggaattca
ttgcggcccagcccctccttcctccacttcctgctgacacatgggcgctggttctgggaa
tttgtcaacgccaccttcatccgtgacatgctcatgcgcctagtactcacagtgcgttcc
aaccttatccccagcccccccacctacaatgtagcacatgactacatcagctgggagtcc
ttctccaatgtgagttattacactcgtgtgctgccctctgtgccccaagactgtcccacg
cccatggggaccaaagggaagaagcagctgccagatgcccagctcctgagcgatcgcttc
ctgctcaggaggaagttcatacctgacccccaaggcaccaacctcatgtttgccttcttt
gcacaacacttcacccaccagttcttcaaaacttctggcaagatgggtcctggcttcacc
aaggccttgggccatggggtagacctcggccacatttatggagacaatctggaacgtcag
tatcacctgcggctctttaaggatgggaaactcaagtaccagatgctgaatggagagatg
tacccgccaacggtggaacaggcgcctgtgttgatgcactacccacggggtattccaccc
cagaaccagatggccgtgggccaggaggtgtttgggctgcttcctgggctcatgctctat
gctacgctctggctacgcgagcacaaccgtgtgtgcgacctgctgaagactgagcacccc
acctgggatgatgagcagctcttccagacggcccgcctcatcctcatcggggagaccatc
aagatcgtgattgaggagtacgtgcagcagctgagcggctacttcctgcagctgaagttt
gacccggagctgctcttcggcgtccacttccagtatcgcaaccgcattgccatggagttc
aaccacctctaccactggcacccactcatgcctgactccttcagagtgggctcccaggag
tacagctataagcagttcctgttcaacacctccatgctggtggactacggggtcgaggcc
ctggttgacgccttttctcgccagatcgctggccggattggtggaggtaggaacctggac
caccatgtcctgcacgtggctgtcgacgtcatcaaggaatcccgagagctgcggctgcag
cccttcaatgagtaccgcaagaggtttggcatgaagccctacgcctctttccaggagctc
actggagagaaggagatggcagctgagttggaggagctgtatggagacatcgatgccttg
gagttctaccctgggctgcttctcgagaagtgccatccaaactccatctttggggagagt
atgatagaaattggagctcccttctccctcaagggcctcctaggcaatcccatctgttct
ccggagtactggaaaccgagtacatttggtggtgaaatgggcttcaacattgtcaagacg
gctacgctgaagaagctggtctgcctcaacaccaacacttgtccctatgtttccttccgt
gttcccaagcgcccccaggatgatgggcctggtgtggagcggccttccacagagctctga

DBGET integrated database retrieval system