Erythrobacter sp. THAF29: FIU90_10460 Help Entry FIU90_10460       CDS       T06318                                  Symbol grxC2 Name (GenBank) Glutaredoxin-3   KO K03676   glutaredoxin 3 Organism erf  Erythrobacter sp. THAF29 Brite KEGG Orthology (KO) [BR:erf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:erf03110]     FIU90_10460 (grxC2) Chaperones and folding catalysts [BR:erf03110]  Protein folding catalysts   Protein disulfide isomerase    FIU90_10460 (grxC2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 SH3BGR GST_N DSBA Glrx-like Motif Other DBs NCBI-ProteinID:  QFT77957 UniProt:  A0A5P9GT15 LinkDB All DBs Position complement(2143167..2143430) Genome browser AA seq 87 aa AA seqDB search MSQPKIDVYSKFACPFCVRAKRLLKAKGVDFNEYDITLGGPKREEMMQRAPNAMTVPQIF IGDMHVGGSDDLAALEREGKLDALLAG NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagccagccgaaaatcgacgtttacagcaagttcgcttgcccgttctgcgtgcgcgcg aaacggcttctgaaagccaaaggcgtcgacttcaacgagtacgacatcacgcttggcgga ccgaagcgcgaagagatgatgcaacgcgctcccaacgcgatgactgttccgcagatcttt atcggcgatatgcatgtcggcggatcggatgacctggccgcgctcgaacgcgaaggcaag ctcgacgcgctgctggcagggtag

DBGET integrated database retrieval system