KEGG   Enterobacter roggenkampii: BFV67_06570
Entry
BFV67_06570       CDS       T05556                                 

Definition
(GenBank) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
ern  Enterobacter roggenkampii
Pathway
ern00052  Galactose metabolism
ern00500  Starch and sucrose metabolism
ern01100  Metabolic pathways
ern01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ern00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BFV67_06570
   00500 Starch and sucrose metabolism
    BFV67_06570
Enzymes [BR:ern01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     BFV67_06570
SSDB
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 DUF4968
Other DBs
NCBI-ProteinID: AOP94853
LinkDB
Position
complement(1415326..1417689)
AA seq 787 aa
MKTLKNWTVDTQSANHLELLVDNQHRLCLYVLEENLFRVLIKRKGELALDRTWSIAPEQD
VPWEGRRRDDLSGFTCPAWMLTQQDDTLTVATEQLRVTVHQPLWLEWHYRNDAGEWQPLV
NDRPTSAYLLNAHGDGVAHYLSRRKDERFYGLGEKAGDLQRNGKRYEMRNLDAMGYNAAS
TDPLYKHIPFTLTRRDDVSYGLFYDNLSSCWLDLGNEIDNYHTAYRRWQAEAGDIDYYLF
TGRRVLDVTKAFVRLTGKTLFGPKWSLGYSGSTMHYTDAPDAQNQLMNFIRLCEEHAIPC
DSFQLSSGYTSINDKRYVFNWNYDKVPQPKVMSQAFHDAGMKLAANIKPCLLQDHPRYSE
VAERGLFIRDSETDAPERSSFWDDEGSHLDFTNPQTVQWWQNGVTTQLLEMGIDSTWNDN
NEYEVWDGEARCFGFGKEIAIKHIRPVMPLLMMRASLEAQQRFAPEKRPYLISRSGCAGM
QRYVQTWSGDNRTNWDTLRYNIRMGLGMSLSGLFNVGHDVGGFSGDKPDAELFVRWVQNG
VMHPRFTIHSWNDDHTVNEPWMYPGVTPAIRGAIELRYRLLPYLYTLLWQAHADDEPMLR
PTFLDHEHDAQTFKECDDFLLGRDLLVASVVEAGQRERRVWLPDNETGWYDFYTHAWYAG
GQSIALDAPLEKLPLLVRAGAGLPLSERITHVSAEKDTTRELKLFPVKGVGTTTGLLFED
DGESWGYLNGNALWVEWEMVCDGATINLKVNARGDYCPAWKALKVSLPAGEKRTLRVNGV
ERSEWVL
NT seq 2364 nt   +upstreamnt  +downstreamnt
atgaaaaccctgaaaaactggaccgttgatacgcagtcggcaaaccatcttgaactgctg
gtcgataaccagcaccgtctgtgcctgtatgtgctggaagagaacctgttccgcgtgctg
atcaaacgcaaaggcgagctggcgctggaccgcacctggagtatcgccccggaacaagac
gtgccgtgggaaggtcgccgtcgtgacgatctgagcggcttcacctgcccggcctggatg
ctgacgcagcaggacgacacgttaaccgtggcaaccgaacagctgcgcgtcaccgtgcac
cagccgctgtggctggagtggcactaccgcaatgacgcgggcgagtggcagccgctggtc
aacgaccgccccaccagcgcctacctgctgaacgcccacggcgacggcgtggcgcactac
ctgagccgccgcaaggacgagcgtttctacggcctgggtgagaaagcgggcgatctgcag
cgcaacggtaaacgctacgagatgcgcaacctcgacgcgatgggatacaacgccgccagc
accgatccgctgtacaagcacattccgttcaccctcacccgccgcgacgacgtgagctac
ggcctgttctacgacaacctgagcagctgctggctggatctgggtaacgagatcgacaac
taccacaccgcctatcgccgctggcaggcggaagcgggcgatatcgactactacctcttt
accggcagacgcgtgctggacgtcactaaagcctttgttcgcctgaccggaaaaacgctg
ttcggaccgaaatggagcctgggctacagcggctcaaccatgcactacaccgacgcgccg
gacgcgcagaatcagctgatgaactttattcgcctgtgcgaagagcacgccattccgtgc
gactcgttccagctttcgtctggctatacctccatcaacgacaagcgctacgttttcaac
tggaactatgacaaggtgccgcagccgaaggtgatgagccaggccttccacgacgcggga
atgaagcttgcggcgaacatcaagccgtgcctgctgcaggaccatccgcgctacagcgaa
gtggcggaacgcgggctgttcattcgcgattcagaaaccgatgcacccgaacgctccagc
ttctgggatgacgaaggctcacacctcgactttaccaacccgcaaacggtgcagtggtgg
cagaacggcgtcaccacgcagctgctggagatgggcatcgactccacctggaacgacaat
aacgaatatgaagtgtgggacggggaagcccgctgctttggcttcggcaaggagatcgcc
atcaaacatattcgcccggtgatgccgctgctgatgatgcgcgcctcgctggaagcgcag
cagcgctttgcgccggaaaagcgtccgtatctgatctcccgctccggctgcgccgggatg
cagcgctacgtccagacctggagcggcgacaaccgcaccaactgggacaccctgcgctat
aacatccgcatggggctgggcatgagcctgtccgggctgttcaacgtcgggcacgacgtc
ggcggtttctccggcgacaagccggacgccgagctgttcgtgcgctgggtgcagaacggc
gtgatgcacccgcgctttaccattcactcgtggaacgatgaccacacggtgaacgagccg
tggatgtatccgggcgtcacgcctgccattcgcggcgcgattgagctgcgctaccgcctg
ctgccgtatctctacaccctgctctggcaggcgcacgccgacgacgagccgatgctgcgc
ccgaccttcctcgaccacgagcacgacgcgcaaaccttcaaagagtgcgacgacttcctg
ctgggccgcgacctgctggtcgccagcgtcgtcgaagccgggcagcgcgagcgccgcgtc
tggctgccggataacgaaacgggctggtacgatttttacacccacgcgtggtatgcgggc
ggacaatccatcgccctggatgcgccgctggaaaaactgccgctgctggtgcgcgccggg
gccggtctgccgctcagcgagcgcatcacgcatgtgagtgccgaaaaagatacgacccgc
gagctgaagctgttcccggtgaaaggcgtgggcacaaccacggggctgctgtttgaagac
gacggtgaaagctggggctacctgaacggcaatgcgctgtgggtggaatgggagatggtg
tgcgacggcgcaaccatcaacctgaaggtgaacgcgcgcggcgactattgtccggcatgg
aaggcgctgaaggtatcattaccggcgggggaaaaacgtacgctgcgggtgaacggggtt
gaaaggagtgagtgggtgctctga

DBGET integrated database retrieval system