KEGG   Enterobacter roggenkampii: BFV67_14080Help
Entry
BFV67_14080       CDS       T05556                                 

Definition
(GenBank) bifunctional imidazole glycerol-phosphate dehydratase/histidinol phosphatase
  KO
K01089  imidazoleglycerol-phosphate dehydratase / histidinol-phosphatase [EC:4.2.1.19 3.1.3.15]
Organism
ern  Enterobacter roggenkampii
Pathway
ern00340  Histidine metabolism
ern01100  Metabolic pathways
ern01110  Biosynthesis of secondary metabolites
ern01230  Biosynthesis of amino acids
Module
ern_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ern00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BFV67_14080
Enzymes [BR:ern01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.15  histidinol-phosphatase
     BFV67_14080
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.19  imidazoleglycerol-phosphate dehydratase
     BFV67_14080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPD HAD_2 PNK3P Hydrolase_like HAD Hydrolase
Motif
Other DBs
NCBI-ProteinID: AOP96271
UniProt: A0A1S2A6I9
LinkDB All DBs
Position
2986743..2987810
Genome map
AA seq 355 aa AA seqDB search
MTQKILFIDRDGTLISEPPADFQVDRFDKLAFEPDVIPVLLKLQKAGYKLVMITNQDGLG
TDSFPQADFDGPHNLMMQVLTSQGVVFDEVLICPHMPADECDCRKPKVKLVERYLAEDVL
DKTNSYVIGDRITDITLAENMGIAGLRYDRNNLNWAMIGEQLTKRDRYSHVERNTKETQI
DVKVWLDREGGSKIHTGVGFFDHMLDQIATHGGFRMEIAVKGDLYIDDHHTVEDTGLALG
EALKLALGDKRGINRFGFVLPMDECLARCAMDISGRPHLEYKADFNYQRVGDLSTEMVEH
FFRSLSYTMGLTLHLKTKGKNDHHRVESLFKAFGRTLRQAIRVEGDALPSSKGVL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaagatccttttcatcgatcgtgacggcacccttatttcggagccaccagct
gattttcaggtcgaccgattcgacaagctggcgtttgaacctgacgtgatcccggtgctg
ctcaagctgcaaaaagccgggtacaagctggtgatgatcaccaaccaggacggtctgggt
accgacagcttcccgcaggcagactttgacggcccgcataatctgatgatgcaggtgctg
acttctcagggcgtggtgtttgatgaagtgctgatttgcccgcacatgccagccgacgag
tgcgactgccgtaagccaaaggtgaagctggtcgagcgctatctggcggaggatgtgctg
gataagaccaacagctatgtcatcggcgatcgcatcaccgatattacgctggcggagaac
atgggcatcgcggggctgcgctatgaccgcaacaaccttaactgggcgatgattggcgag
cagctgacaaaacgcgaccgctactcgcacgttgaacgcaacaccaaagagacgcagatt
gatgtgaaggtctggctggaccgcgaaggcggcagcaagatccacaccggcgtgggtttc
ttcgaccacatgctggaccagattgccacccacggcggtttccgcatggagatcgcggta
aaaggcgacctctatattgacgatcaccacaccgtggaagataccggcctggcgctgggt
gaagccctgaagctggcgctcggtgataaacgcggtatcaaccgttttggctttgtcctg
ccaatggacgagtgtctggcgcggtgcgcgatggatatctccggccgtccgcacctggaa
tataaagcagacttcaattaccagcgcgtgggcgatctgagcaccgaaatggtggagcac
ttcttccgttcattgtcctacaccatgggcctgacgctgcacctgaagaccaaaggcaag
aacgaccaccaccgcgtggagagtctcttcaaggcctttggccgcacgctgcgccaggca
attcgcgtggaaggtgacgccctgccctcatcaaaaggagtgctgtaa

DBGET integrated database retrieval system