KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum7910
Entry
Erum7910          CDS       T00224                                 

Gene name
probable_gatC
Definition
(GenBank) putative glutamyl-tRNA(Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
eru00970  Aminoacyl-tRNA biosynthesis
eru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eru00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Erum7910 (probable_gatC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:eru03029]
    Erum7910 (probable_gatC)
Enzymes [BR:eru01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Erum7910 (probable_gatC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Erum7910 (probable_gatC)
Mitochondrial biogenesis [BR:eru03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Erum7910 (probable_gatC)
SSDB
Motif
Pfam: Glu-tRNAGln
Other DBs
NCBI-ProteinID: CAH58525
LinkDB
Position
1351586..1351930
AA seq 114 aa
MIRNKLIDNQNNSNNLQQKKITKDDLLQVAKLVKVKLSDNEIGYYIKELESVLSWINTIS
QVNTDNVIPMSHGGISHKLPLRQDIINDGNIKDIILSESPKQEHDFFVVPKVIE
NT seq 345 nt   +upstreamnt  +downstreamnt
atgataagaaacaaattgatagacaatcaaaataattcaaataacttgcaacagaaaaag
ataaccaaggatgatctgctacaagttgcaaagttagtcaaagtaaaattgagtgacaat
gaaatcggttattatattaaggagttagaatctgttttgagttggataaatacaatatca
caagtaaacacagacaatgttatcccaatgagtcatggtggaataagtcataaattacct
ctacgtcaagacattatcaatgatggcaatataaaagacattatactttctgagtctcct
aaacaagaacatgacttttttgttgtaccaaaagtcattgagtaa

DBGET integrated database retrieval system