Erwinia sorbitola: GN242_12940 Help Entry GN242_12940       CDS       T06366                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism erwi  Erwinia sorbitola Pathway erwi01100   Metabolic pathways erwi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:erwi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GN242_12940   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GN242_12940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QGU88077 UniProt:  A0A6I6EE05 LinkDB All DBs Position complement(2877375..2877644) Genome browser AA seq 89 aa AA seqDB search MEELSLEIKQMIIDTLNLEEVSVMDIETDAPLFGDGLGLDSIDALELGLAVKTRYGVVLS AESDEMRQHFYSVATLAAFIHAQRSALTA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggaagagttatcgctcgaaattaaacagatgattatcgacacgcttaatctggaagag gtcagcgtgatggatattgaaaccgacgcaccgctgtttggtgatggtctgggccttgat tccatcgacgcgctggagctgggcctcgcggtgaaaacccgttacggcgtggtgctctct gcggaaagcgacgaaatgcgccagcacttttattccgttgccaccctggcggcgtttatt catgcccagcgttcagcgctgacggcctga

DBGET integrated database retrieval system