KEGG   Enterobacter lignolyticus SCF1: Entcl_0285Help
Entry
Entcl_0285        CDS       T01342                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00250  Alanine, aspartate and glutamate metabolism
esc00410  beta-Alanine metabolism
esc00640  Propanoate metabolism
esc00650  Butanoate metabolism
esc01100  Metabolic pathways
esc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:esc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Entcl_0285
   00650 Butanoate metabolism
    Entcl_0285
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Entcl_0285
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Entcl_0285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:esc01007]
    Entcl_0285
Enzymes [BR:esc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Entcl_0285
Amino acid related enzymes [BR:esc01007]
 Aminotransferase (transaminase)
  Class III
   Entcl_0285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADO46563
UniProt: E3GAY2
LinkDB All DBs
Position
308497..309762
Genome map
AA seq 421 aa AA seqDB search
MKNNELNQRRLQATPRGIGVMCGFYAEKAENATLWDTDGNEVTDFAAGIAVLNTGHRHPK
VVAAVEKQLRAFTHTAYQIVPYESYVSLAERINARVPVNGPAKTAFFTTGAEAVENAVKI
ARFYTKRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVFHGQYPNPLHGVSTA
DALKSLERIFKADIAPDQVAAIILEPVQGEGGFNVAPADFMQGLRKICDTHGILLIADEV
QTGFARTGKLFAMEHYDVKPDLMTMAKSLAGGMPLSAVAGRAEVMDAPAPGGLGGTYAGN
PLAIAAAHAVLDVIDEEKLCARSAELGHHLVEVLNNAKADCPYIADVRAQGSMVAVEFND
PHSGEPSPEFTKQFQDKALQQGLLLLSCGVYGNVIRFLYPLTIPEAQFRKALDIIRHSLS
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataacgaactgaatcagcgccgcctgcaggcgacgccgcgtgggattggcgtc
atgtgcgggttctatgccgaaaaagcggaaaacgccaccctgtgggatacggacggcaac
gaggtcaccgatttcgcggccggtatcgccgtgctcaacaccggccaccgccacccgaag
gtggtcgcggcggttgaaaaacagctgcgcgcctttacccatacggcctatcagattgtt
ccttacgaaagctatgtgtcgctggccgagcgtattaacgcccgcgttccggtcaacggt
ccggcgaagaccgcgttcttcaccaccggcgcggaagcggtggaaaacgccgtgaagatt
gcccgcttctacactaaacgtccggggctgattaccttcggcggcggcttccacggccgt
acctttatgaccatggcgctgaccggcaaagtggcgccgtacaagattggcttcgggccg
ttcccgggctcggtgttccacgggcagtacccgaacccgctgcacggcgtcagcaccgcc
gatgcgctgaaaagccttgagcgtattttcaaagccgacatcgccccggatcaggtggcg
gccattatccttgagccggtgcaaggagagggcggctttaacgtggcgccagccgatttc
atgcaggggctgcgtaagatttgcgacacccacggcattctgctgatcgctgacgaagtg
cagaccggctttgcccgtaccggtaagctgttcgcgatggagcactacgacgtcaagccg
gacctgatgaccatggcgaagagcctggcgggcggtatgccgctgtcggccgtcgccggt
cgcgcggaggtgatggacgccccggcgccaggcggtctgggcggcacctacgccggtaac
ccgctggcgatcgccgcggcgcatgcggtgctggacgtcatcgacgaagagaagctgtgc
gcccgttccgccgagctgggccaccatctggtggaagtgctgaacaacgcgaaggccgat
tgtccgtatatcgccgacgtccgcgcgcagggctccatggtggccgtggagttcaacgac
ccgcacagcggcgaaccgtcgccggaatttaccaaacagttccaggataaagcgctgcaa
caaggtctgctgctgctgagctgcggcgtctacggcaacgttatccgcttcctttaccct
ctgaccatccctgaagcccagttccgcaaggcgctggacattattcgacactccctcagc
cgctaa

DBGET integrated database retrieval system