KEGG   Escherichia coli O104 H4 2011C-3493: O3K_06240Help
Entry
O3K_06240         CDS       T02257                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
esl  Escherichia coli O104:H4 2011C-3493
Pathway
esl00250  Alanine, aspartate and glutamate metabolism
esl00280  Valine, leucine and isoleucine degradation
esl00410  beta-Alanine metabolism
esl00640  Propanoate metabolism
esl00650  Butanoate metabolism
esl01100  Metabolic pathways
esl01120  Microbial metabolism in diverse environments
Module
esl_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:esl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    O3K_06240
   00650 Butanoate metabolism
    O3K_06240
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    O3K_06240
   00280 Valine, leucine and isoleucine degradation
    O3K_06240
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    O3K_06240
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:esl01007]
    O3K_06240
Enzymes [BR:esl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     O3K_06240
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     O3K_06240
Amino acid related enzymes [BR:esl01007]
 Aminotransferase (transaminase)
  Class III
   O3K_06240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 13702702
NCBI-ProteinID: YP_006777960
UniProt: A0A0E0XWX7
LinkDB All DBs
Structure
PDB: 

Position
complement(1278000..1279280)
Genome map
AA seq 426 aa AA seqDB search
MSSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAASPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELF
EDGDHSKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQC
FAEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagagttaatgcagcgccgcagtcaggcgattccccgtggcgttggg
caaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctgcatccg
aaggtggtggccgcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcttacgagccgtatctggagctgtgcgagattatgaatcagaaggtgccgggcgat
ttcgccaagaaaacgctgctggttacgaccggttccgaagcggtggaaaacgcggtaaaa
atcgcccgcgccgccaccaaacgtagcggcaccatcgcttttagcggcgcgtatcacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggcatgggg
ctgatgccgggtcatgtttatcgcgcgctttatccttgcccgctgcacggcataagcgag
gatgacgctatcgccagcatccaccggatcttcaaaaatgatgccgcgccggaagatatc
gccgccatcgtgattgagccggttcagggcgaaggcggtttctacgccgcgtcgccagcc
tttatgcagcgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggcgcggggcgtaccggcacgctgtttgcgatggagcagatgggcgttgcg
ccggatctcactacctttgcgaaatcgatcgcgggcggcttcccgctggcgggcgtcacc
gggcgcgcggaagtgatggatgccgtcgctccaggcggtctgggcggcacctatgccggt
aacccgattgcctgcgtggcggcgctggaagtgttgaaggtgtttgagcaggaaaatctg
ctgcaaaaagccaacgatctggggcagaagctaaaagacggattgttggcgatagccgaa
aaacacccggagatcggcgacgtacgcgggctgggagcgatgattgccatcgagctgttt
gaagatggcgatcacagcaaaccggacgcaaaactcaccgccgagatcgtggcacgcgcc
cgcgataagggcctgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcagccagtgt
tttgctgaggcgaagcagtag

DBGET integrated database retrieval system