KEGG   Escherichia sp. E4742: FEM44_17470Help
Entry
FEM44_17470       CDS       T06276                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
esz  Escherichia sp. E4742
Brite
KEGG Orthology (KO) [BR:esz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FEM44_17470 (ahpF)
Enzymes [BR:esz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FEM44_17470 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 Thi4 NAD_binding_8 K_oxygenase AlaDh_PNT_C Glutaredoxin DAO FMO-like NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: QCT88849
LinkDB All DBs
Position
3637956..3639521
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNSLPV
RKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRHIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVFVNGKE
FGQGRMTISEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAIYSARKGIRTGL
MGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYDVDVIDSQSASKLIPAAVEG
GLHQIETASGAVLKARSIIVATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKNVDIILNAQTTEVKGD
GSKVVGLEYRDRVSGDIHNIELAGIFVQIGLLPNTNWLEGAVERNRMGEIIIDAKCETNV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaatatgaaaactcaactcaaggcttaccttgagaaattgaccaagcct
gttgagttaattgccacgctggatgacagcgctaaatcggcagaaatcaaggaactgttg
gctgaaatcgcagaactgtcagacaaagtcacctttaaagaagataacagcttgccggtg
cgtaagccgtcattcctgatcaccaatccaggttccaaccagggaccgcgttttgcaggt
tccccgctgggtcacgagtttacctcgctggtactggcgctgctgtggaccggtggtcat
ccgtcgaaagaagcacagtctctgctggagcagattcgccatatcgacggtgattttgaa
ttcgaaacgtattattcgctctcttgccacaactgcccggacgtggtgcaggcgctgaat
ctgatgagcgtactgaacccgcgtattaagcacacggcgattgatggcggtacgttccag
aacgaaatcaccgatcgtaacgtgatgggtgttccggcagtgttcgtaaacgggaaagag
tttggccagggccgtatgactatttccgaaatcgttgccaaaatcgatactggcgcggaa
aaacgtgcggcagaagagctgaacaagcgtgacgcttacgatgtgctgattgtcggttct
ggcccggcaggggctgcggcagcaatttactccgcacgtaaaggcattcgtaccggtctg
atgggcgaacgtttcggcggtcagatcctcgatactgttgatatcgaaaactacatctct
gtgccgaaaaccgaaggccagaaactggcaggcgcgctgaaggttcacgttgatgaatac
gatgttgatgtgattgatagccagagcgcgagcaaactgatcccggcagcggttgaaggc
ggcctgcatcagattgaaacggcttccggcgcagtactgaaagctcgcagcattatcgtg
gcgaccggtgcaaaatggcgcaacatgaacgttccgggcgaagatcagtatcgcaccaaa
ggcgtgacctactgcccgcactgcgacggcccactgtttaaaggcaaacgcgtagcagtc
atcggcggcggtaactccggtgtggaagcggcaatcgacctggcagggattgttgaacac
gtaacgctgctggaatttgccccagaaatgaaagctgaccaggttctgcaggacaagctg
cgcagcctgaaaaacgtcgacatcattctgaatgcgcaaaccacggaagtgaaaggcgat
ggcagcaaagtcgttggtctggaatatcgtgatcgtgtcagcggcgatattcacaacatc
gaactggctggtattttcgtccagattggtctgctgccgaacaccaactggctggaaggc
gcagtcgaacgtaaccgcatgggtgagataatcattgatgcgaaatgcgaaaccaacgtc
aaaggcgtgttcgctgccggtgactgtacgacggttccgtataagcagatcatcatcgct
actggcgaaggtgctaaagcctctctgagcgcttttgactacctgattcgcaccaaaact
gcataa

DBGET integrated database retrieval system