KEGG   Empidonax traillii (willow flycatcher): 114055071
Entry
114055071         CDS       T05887                                 

Gene name
BOC
Definition
(RefSeq) brother of CDO isoform X1
  KO
K20020  brother of CDO
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114055071 (BOC)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 fn3 ig ISET-FN3_linker V-set Pur_ac_phosph_N C2-set_2 Ig_4 Ig_5
Other DBs
NCBI-GeneID: 114055071
NCBI-ProteinID: XP_027734613
LinkDB
Position
Unknown
AA seq 1106 aa
MAMTRGKKRPMSPIPCLVFAAATCFARLSESLQVTVQPASIVQKLGGSVSLGCVVDPPRV
NLTWRLNGRELAGSDEVLGIHVERGKLVITALNNHTVGRYQCIARVPEGVIASVPAVVTL
ANLKDFKFDGQHVIEVDEGNTAVIACDLPESHPKAQVRYSVKQEWLEASRDNYLIMPSGN
LQIVNASQEDEGTYKCAAYNPVTQEVKTSVSSERLRVRRSTAEAARIIYPPETQTIIVTK
GQSLILECVASGIPPPRVTWAKDGSGVSAYNKTRFLLSNLLIDPTSEEDSGTYSCTADNG
VGEAGAAFIFYNVQVFEPPEVTMELSQQIIPWGQSAKFTCEVRGNPQPSVMWLRNAVPLS
ASHRLRLSRRALRLVSVGPEDDGIYQCMAENEVGSAQAMVQLRTARPGTSLNPGRDAQLG
SAQPPTPPSRESALELPLDKTGLPKLETTPLAVSPQCAANRELVAPAEAPIILSSPRTSK
TDSYELVWRPRPDSRAPILYYVVKHRKQVTNASDSWAVKDVPASQHRLTLSRLDPGSLYE
VEMAAHNCAGEGQTAMVTFRTGRRPKPEIVASKEQQIQRDDPGTSTQSSNQSDNSRLSPP
EAPDRPTISMASETSVYVTWIPRGNGGFPIQSFRVEYKKLKKLGDWVLATSDIPPSRLSV
EIPGLEKGTSYKFRVRALNILGESEPSAASRPYVVSGYSNRVYERPVAGPYITFTDAINE
TTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDVVEGDRYWHSISHLQPETSY
DIKMQCFNEGGESEFSNVMICETKARKSLGLPGRLPPSTLPPQQHPPLSGGHSGLGTGAM
MARSSDLPYLIVGVVLGSIVLLIVAFIPFCLWRAWSKQKQTIDMGFPGAGLLVSSCQYTM
VPLRGISAPRANGHPYINGQPYANRAHLSGICPSSGVAYTSTKPRDYSPDEVPPTHEETN
ALLQARVLQNGNAQQDYQPSRLPSSRTEDSSFLYSLPDDSTHQLLQQQDDCPHLQEHFIG
LHHPVMGNKVGCPSLDPRQDTLFHQGSPCCLGLVPVEEVERLECCQSRGDLHSQNPVITS
LGQDLPRHLNSSPPPLRPLETHPPSS
NT seq 3321 nt   +upstreamnt  +downstreamnt
atggcaatgacacgtggaaagaagaggccgatgtcccccatcccttgcctcgtgtttgca
gccgccacctgtttcgccagactgagtgaatctctgcaagtcacagtgcagcctgcttcc
attgtccaaaaacttgggggttcagtcagcctgggatgtgtggtggacccccccagagtg
aacctcacgtggagactgaacgggagggagctggctggatcggacgaggtgctgggtatc
cacgtggagcgagggaaactcgtcatcacagctctcaacaaccacaccgtggggcggtac
cagtgcattgctcgtgtgcctgagggagtcattgccagtgtccctgcagtggtcacatta
gccaatctcaaagatttcaagtttgatggccagcatgtgattgaggtggatgaagggaac
acagctgtgatcgcctgtgacctgcctgaaagtcaccccaaggctcaggtccgctacagt
gtgaagcaggagtggctggaggcctcccgagacaattaccttattatgccatctgggaac
cttcagattgtcaatgccagccaagaggatgaggggacttataaatgtgctgcctacaac
cctgtgacacaggaggtgaaaacttctgtctccagtgagaggctccgtgtgagacgctct
acagcagaggcagcccggataatctaccctcctgaaactcagaccatcattgtcaccaag
ggccaaagcctcatcctggagtgcgtagccagcgggattcccccgccgcgggtcacctgg
gccaaagacggctccggtgtctcggcatacaacaagacacgcttcctgctcagcaacctc
ctgattgaccccacgagtgaggaggactcgggcacctacagctgcacggctgacaacggg
gttggggaggccggagctgcgttcatcttctacaacgtgcaggtgtttgagcccccggag
gtcaccatggagctgtcccagcagatcattccctggggccagagcgccaagttcacctgc
gaggtgcgagggaacccccagccctccgtcatgtggctgcgcaacgctgtccccctgtcc
gccagccaccggctccggctgtcccgccgggcactgcgcctggtcagcgtggggcccgag
gacgacgggatataccagtgcatggcagagaacgaggttggcagtgcacaagccatggtg
cagctgcggacagcccggccgggaacttcactcaaccctgggcgagatgcgcagctgggc
tcagctcagcctccaacaccaccttctagggaaagtgctttagagctgcccctggataaa
actgggttgccaaagcttgagacaactccgctggcagtgtctccacagtgtgcagccaac
agggagctggtggctccagccgaggcccccatcatcctcagttctccccggacatccaag
acggacagctacgagctggtgtggagaccccgtcctgacagcagagcccccatcctctat
tacgtggtgaagcatcgcaagcaggtcaccaatgcctcggacagctgggcagtgaaggat
gtcccagcctcgcagcaccgcctgaccctctccaggctggaccctgggagcctctacgag
gtggagatggctgctcacaactgtgccggcgagggacagacggccatggtgaccttccgg
actggtcggcgcccaaaaccagagattgttgccagcaaagagcagcaaatccagagggat
gacccaggcacgagcactcagagcagtaaccagtctgacaacagccgtctgtcccctcca
gaggcaccagaccgtccaaccatctctatggcatcagagacatctgtgtacgtgacctgg
atcccccgtgggaatggcggcttccccatccagtctttccgtgtggaatacaagaaattg
aagaagttgggagactgggtcctggccaccagtgacattcctccctctcgcctctctgta
gaaatcccaggcctggagaaaggcacatcctataaattccgtgtccgggcactgaacatc
ctgggagagagtgagcccagtgcagcgtctcggccatacgtggtgtctgggtacagcaac
cgggtctatgagcgccctgtggcggggccatacatcaccttcacagatgccatcaacgag
accaccatcatgctgaagtggatgtatatcccagccagcaacaacaacactcccattcat
ggattttacatctattaccgccccactgacagtgacaatgacagcgactacaagaaggac
gtggtggaaggagatcggtactggcactccatcagccacctgcagccagagacctcgtat
gacattaagatgcaatgcttcaatgagggtggcgaaagcgagttcagcaacgtgatgatc
tgcgaaaccaaagctcggaagtcccttggcctgccaggtcgtcttccaccctccacgctg
cccccccagcagcatcccccactgagtggtgggcacagtggcctggggacaggagccatg
atggcccgttccagtgacttgccatacttgattgtaggcgttgtgctgggctctattgtg
ctcctcatcgtggctttcatccccttttgcctttggagagcctggtccaagcagaagcaa
accatcgacatgggctttccaggagctgggctgctggtctcatcctgccagtacaccatg
gtgccgctgaggggcatttctgctcctcgtgccaatggacacccctacattaatgggcag
ccctacgccaacagggcacatttgagtggcatctgcccctcctcaggagtggcgtacaca
agcaccaagccccgagattacagcccagatgaagtgccaccgacacatgaggagaccaac
gccttgctccaggcaagagtgctgcaaaatgggaatgcccagcaagactaccagccctcc
agattgcccagttcaagaacagaagacagctctttcctctacagtcttccagatgactcc
acccaccagcttcttcagcaacaagacgactgtcctcaccttcaagagcactttattggc
ctccatcatccagtaatgggaaacaaagtgggatgccctagcctggatcctcgacaggac
accttgttccaccaaggaagcccttgctgcctaggcctagtgccagttgaagaggtagaa
agactagagtgctgccagtccagaggagatctccattcccagaacccagtgatcacgtct
ttgggtcaggatctaccaagacacctgaacagcagcccgccaccactgagacccttagag
actcaccctccctccagctag

KEGG   Empidonax traillii (willow flycatcher): 114055999
Entry
114055999         CDS       T05887                                 

Gene name
GAS1
Definition
(RefSeq) growth arrest-specific protein 1
  KO
K06232  growth arrest-specific 1
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114055999 (GAS1)
SSDB
Motif
Pfam: GDNF
Other DBs
NCBI-GeneID: 114055999
NCBI-ProteinID: XP_027736576
LinkDB
Position
Unknown
AA seq 324 aa
MVARSPARHGGGGRPWPRAAVWLWLAAALGAVWPPRGSLVQGRRLICWQAVLQCQGEPEC
SYAYNQYAEACAPVLLQQQPAAGGGDGPAGAAGAAAPSRRRCPSHCIAALIQLNHTRRGP
ALEDCDCAQDENCRATKRAIEPCLPRTSSPAGGGPGGSGPGGPGVMGCTEARRRCDWDSR
CSLALNRYMTYCGKLFNGLRCTPECRAVIEDMLAVPKAVLLNDCVCDGLERPICESVKEN
MARLCFGADMGGNGAGSSGGSDGGLEEYYDEDYEEEPSQKGRDDAEDNAGADPSFPVQAD
SAGRPAAAAAALLASVLLPLLPRL
NT seq 975 nt   +upstreamnt  +downstreamnt
atggtggcccgctcgcccgctcggcacggaggcggcgggcggccctggccgcgggcggcc
gtctggctgtggctggcggcggcgctgggcgcagtgtggccgccgcggggctcgctggtg
cagggccggcggctgatctgctggcaggcggtgctgcagtgtcagggggagcccgagtgc
agctacgcgtacaaccagtacgccgaggcgtgcgccccggtgctcctgcagcagcagccg
gcggcgggcggcggggacggcccggcgggcgctgcaggcgcagccgccccctccaggcgg
cggtgccccagccactgcatcgcggcgctcatccagctcaaccacacccggcgcggcccg
gcgctggaggactgcgactgcgcgcaggacgagaactgccgcgccaccaagcgcgccatc
gagccctgcttgccccgcaccagcagccccgcgggcggtggccccggcgggtccggcccc
ggcggccccggcgtcatgggctgcacggaggctcggcggcgctgcgactgggacagccgc
tgcagcctggcgctgaaccgctacatgacctactgcgggaagctgttcaacgggctgcgc
tgcacgcccgagtgccgcgctgtcatcgaggacatgctggccgtgcccaaggccgtgctg
ctcaacgactgcgtctgcgacgggctggagaggcccatctgcgagtcggtcaaggagaac
atggcccgcctctgcttcggcgccgacatgggcggcaacggcgcgggcagcagcggcggc
tcggacggcggcctggaggagtactacgacgaggactacgaggaggagccgagccagaag
gggagggacgacgcggaggacaatgccggcgccgatcccagcttcccagtgcaggcggat
agcgctggccggcctgccgcggctgccgcggcgctgctcgcctccgtcttgctgcccctg
ctgccgcggctctag

KEGG   Empidonax traillii (willow flycatcher): 114064593
Entry
114064593         CDS       T05887                                 

Gene name
CDON
Definition
(RefSeq) cell adhesion molecule-related/down-regulated by oncogenes
  KO
K20033  cell adhesion molecule-related/down-regulated by oncogenes
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114064593 (CDON)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 fn3 ig V-set Pur_ac_phosph_N BiPBP_C Tissue_fac EphA2_TM
Other DBs
NCBI-GeneID: 114064593
NCBI-ProteinID: XP_027753587
LinkDB
Position
Unknown
AA seq 1243 aa
MHPAPGRFQALLLIAGLVAATSPDLTPSFISEPSSTIQKSGEPVQLHCSAEPSTARLSWL
FNGEPLDSRAGEVEVQPGSLTIVSLSPATCGRYQCVASSSVGAVLSRPATVSMGSLADFD
ASLTAAVAAEEGGSALIGCKVPESHPNAQVRFQVRGKWLEQSVENYLILPSGNLQILNVS
LEDKGSYKCAAYNPVTHDLRVEPTGRKLTVTRPSSGGSHILHPLAPQSLAVPLHSALTLE
CVVSGAAPSVRWAKDGRDVLGRGRWKLLHSHLVTDRLEASDAGNYSCLVGGDSGAVKYVN
YSLTVLEPASLSKGLQEETVATGATVHFWCDVRGSPAPALSWLHNAAPLRPSPRHFPTGN
HLRICGVTLADSGLYQCVANNGIGFVQSTGRLRVRPGTGSVPVIVSSPGSVTVVAGGDVT
LSCNATGLPAPAIRWYDSRGLLTSHPAQELHPNVQRPPLAGLEHSCLSVSQAGWSSLSLR
NVTPERAGEFSCEAINEHGSAVSKTFLTVVPPATGTRAGETAPLELAQSDESGADSGAEA
AFSSSPPTKAPPDAAAMEKAPSVAAPPEAPIILSPPQTPKPDTYSLVWRPGRAGGLPINA
YFVKYRKLEDSVSAAGSWHTVRVPGSENELRLTELEPSSLYEVLMVARSAAGEGQPAMLT
FRTSKERTSSLKNTQAPSPPMGIPKQPVVHEGTNNFGVVLPDLSRHSGVPEAPDRPTIST
ASESSVYVTWIPRANGGSPITAFKVEYKRLGRNSDWLVAADNISPSKLSVEVRNLEPGEM
YRFRVIAVNNYGESPRSAASRPYQVAGFTSRFSSRPIAGPHIAYTEAVSDTQIMLKWTYI
TSSNNNTPIQGFYIYYRPTDSDNDSDYKRDIVEGTKQWHLINHLQPETSYDIKMQCYNEG
GESEYSNVMICETKVKRTPGASEYPVKDLSTPPSAPERAGGSGAGPASGPVRSSDMLYLI
VGCVLGVMVLILIVFIAMCLWKNRQQSAMQKYDPPGYLYQGADITAQMIEYTTLPGTSRV
NGGIHGSFLGNGLGNGCPHLHHKVGNGVNGIMNGGAGLYPGHTNSLSRTHVDYEHPHHLV
NGSGMYSAVPQADPSECISCRNCRNNNRCFTKANGTFGSAALPVVPLGAPFPQDGVEMKP
LSPHVMVAMCLASAGPECGARLEEDGEESAEPPRHPCCQQGVSRDCTDGDSCVHSETSNH
ILSWSPLILQPVSKDCKEKPGWSSSRVTLNSSGDLRQLQLQET
NT seq 3732 nt   +upstreamnt  +downstreamnt
atgcatccagcccccgggcgcttccaggcactgctcctcatcgccggcctcgtcgctgcc
accagcccagatttaactccaagttttatttctgagccctcttctaccatccagaagtct
ggtgagcccgtccagctccactgctctgccgagccctccacagctcgcctttcttggctg
tttaatggggagcctctggacagcagggcgggagaagtggaagtccagccaggatctttg
acaatcgtctccctcagccccgcgacgtgtgggcgctaccagtgcgtggccagcagcagc
gtgggcgccgtgctgagccggcctgccaccgtgtccatgggcagtctggctgactttgat
gcctcgctgacagctgctgttgcagcggaggaaggaggctcagctctcatcgggtgcaag
gtgccagaaagtcaccccaacgcacaggttcgcttccaagtgcgggggaaatggctggaa
caatcagtagaaaactacctaattcttccatctggaaacctgcagattttgaatgtatct
ttagaagacaaaggatcctacaaatgtgcagcatacaacccagtcactcatgatctcaga
gtagaacccactggacgtaagctcacagtcacacgcccttcctcaggtggctcccacatc
cttcaccccctggccccccagagcctggcagtgcccctgcacagtgccctgacactggag
tgtgtggtcagcggggcggctccctcggtgcgctgggccaaggacggccgggatgtgctg
gggcgaggccggtggaaactgctgcactcccacctggtgacagaccggctggaggcatca
gatgctggaaactactcctgcctggtgggaggtgactctggagcagtgaaatacgttaac
tattcacttactgtacttgaacctgcctcactctccaaggggctgcaggaggaaaccgtg
gccaccggggcgacggtgcatttctggtgtgatgtccggggcagccctgctccagccctc
tcctggctccacaacgcagctcccctgcgcccctccccacggcacttcccaacgggaaac
cacctgcggatctgcggggtcaccctggcggactctggcttgtaccagtgcgtggcaaac
aatgggattgggtttgtgcagtccacggggagactccgtgtccggccaggcacaggctct
gtccccgtcatagtctcttcccccgggagtgtcaccgtggtggccggtggggacgtgacg
ctgtcctgcaatgccaccgggctgcccgcgcccgccatccgctggtacgacagcaggggc
ctgctgaccagccaccctgcccaggagctgcatcccaacgtgcagaggcctcccctggca
gggctggagcactcctgcctctccgtgtcccaggcaggctggagctccttgtccctgcgg
aacgtgactccggagcgtgccggggagttcagctgcgaagccatcaacgagcacggctct
gccgtgtccaaaaccttcctcacagttgttcctccagcaactggcacgagagcaggagaa
acagctcctctggagcttgcccagagcgatgagagcggggctgattccggagcagaagcg
gcgttttcaagctcccctccgaccaaagcgcctccggacgcggctgcgatggagaaagcg
ccgagtgtggccgccccgcccgaggcccccatcatcctgagccccccccagacaccaaaa
cccgacacctacagcctggtgtggcggccaggccgggctggggggctgcccatcaatgcc
tacttcgtcaaataccgcaagctggaggacagcgtgagtgcagcgggcagctggcacacc
gtgcgtgtccccggcagcgagaacgagctgcggctgacggagctggagccctccagcctc
tacgaggtgctgatggtggcccggagcgccgccggcgagggccagcccgccatgctgacc
ttccgcaccagcaaggaaagaacatcatccttgaaaaacactcaggctccatctccaccc
atgggcatccctaaacaacccgttgttcatgaaggcacaaataatttcggtgttgtcctt
ccagacctgtctcgccacagtggagttccagaagctccagaccgacccaccatctccaca
gcatcggaatcgtccgtctacgtcacgtggatcccccgggccaacgggggctcccccatc
acagccttcaaagtggagtacaaacgcctgggtcgcaacagcgactggctcgtcgcagct
gacaacatctccccctccaagctgtccgtggaagttcggaacctggagccaggagaaatg
tacaggttccgtgtgatcgcggtgaacaactacggggagagcccgcgcagcgccgcgtcc
cgcccgtaccaggtcgccggcttcaccagccgcttctccagccgccccatcgccggaccc
cacatcgcctacaccgaagccgtcagcgacactcagatcatgctgaaatggacgtacatt
acatccagcaacaacaacacgcccatccaagggttttatatctattaccggcccacggac
agtgacaacgacagtgactacaagcgggacattgtggaaggtacgaagcagtggcacctg
ataaatcacctgcagcctgaaacttcttatgacattaagatgcagtgctataacgagggc
ggggagagcgagtacagcaacgtgatgatctgcgagaccaaagtgaaacgcacgccggga
gcgtccgagtacccggtgaaggacctgagcaccccgcccagcgccccggagcgggcaggg
ggcagcggggccgggcccgccagcggccccgtgcgcagcagtgacatgctctacctgatc
gtgggctgtgtcctgggcgtcatggtcctcatcctcatcgtcttcattgccatgtgcctc
tggaagaaccggcagcagagcgccatgcagaagtacgaccctcctgggtacctctaccaa
ggggcagatatcaccgcgcagatgatcgagtacacgaccctgcccgggaccagccgcgtc
aacggcggcatccacgggagcttccttggcaacggcctcggcaacggctgcccccacctc
caccacaaagttggcaatggagtgaacgggatcatgaatggaggagcaggactgtaccca
gggcacaccaactccctgtccaggacacacgtggactatgagcacccccaccacctcgtg
aacggttccgggatgtactcggcagtgccgcaggctgacccctcggagtgcatcagctgc
cggaattgccggaacaataacaggtgtttcaccaaagccaacggcactttcggcagcgcc
gccctgcccgtggtgcccctcggagcgcccttcccgcaggacggtgtggagatgaagccc
ctgagcccccacgtgatggtggccatgtgcttggcctcggccggccccgagtgcggcgcc
cggctggaggaggacggcgaggagagcgcggagcccccccggcacccctgctgccagcag
ggcgtgagcagggactgcacggacggcgacagctgcgtgcactcagaaacatcgaaccac
attttgagctggagtcccctcattctgcagcctgtttccaaggactgtaaggaaaaacca
ggatggagttcatccagagtcaccttaaacagttctggggaccttcggcagctccagctg
caggaaacctga

KEGG   Empidonax traillii (willow flycatcher): 114073754
Entry
114073754         CDS       T05887                                 

Gene name
LRP2
Definition
(RefSeq) low-density lipoprotein receptor-related protein 2 isoform X1
  KO
K06233  low density lipoprotein-related protein 2
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114073754 (LRP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:etl04131]
    114073754 (LRP2)
Membrane trafficking [BR:etl04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    114073754 (LRP2)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition DUF5050 cEGF SGL EGF_CA
Other DBs
NCBI-GeneID: 114073754
NCBI-ProteinID: XP_027767326
LinkDB
Position
Unknown
AA seq 4662 aa
MGPRHRMDGRAATACKLLILFTACIMRGSCQGCERGQFRCGNGRCIPADWRCDGARDCSD
DTDEAGCPQPTCEGNQFQCQTDGECIPQSWVCDDEEDCEDGSDEHQQCPGRTCSSEQFTC
SNGQCIPSTYWCDRVEDCTDGTDERACHYPRCEQLSCANGACFNASQRCDGKVDCRDSSD
EANCTRGCTSTQFQCANGECIPRAFLCDHDDDCGDRSDENSCTYATCRGNFFTCPSGRCI
HQSWICDGDDDCEDNEDERGCESGRQECYPGEWACPGSGHCIPIGKVCDGTADCPEGEDE
TNITAGRHCNISRCAALSCQYRCHSSPSGGMCYCPAGYTISGNDSRTCIDFDDCKMWGVC
DQLCEDRVGHHQCHCVEGYFLEHHRHCRANTSAGVASIIFSNGRDLLIGDLHGRNFRTLV
QSRNRGVAVGVDFHFYLRRIFWTDTVQDKVFSINIDGSDLQEVLNISVDTPENLAVDWVN
NKLYVVETSVNRIDMVNLDGTNRVTLIAENLGNPRGIALDPTVGYLFFSDWDSLSGDPKV
ERAFMDGTNRQDLIKTKLGWPAGITLDIVSKRLYWVDSRFDYIETVTYDGLQRRTVAHGG
SLIPHPYGITLFEHNVYFTDWTKMAVVKANKFSESNPQVIYQSSLRPYGVTVYHAARQPY
ARNPCGSNNGGCEQVCVLSHKTDNDGLGYRCRCILGFDLHVDGRHCVAVRQFLLFSSQMA
VRGIPFNLSSQEDVIIPVTGSPSYFVGIDFCAQDDTIFFSDTSKDVIYKQKTDGSGREIL
TANRVESVEDLAFDWISKNLYWTDPRYRSISVMRLADKSRRAIVQNLNNPRSIVVHPVVG
YIFWTDWFRPAKIMRAWSDGSHALPIVNTTLGWPNGLAIDWSSLRLYWVDAFFDKIEHST
FDGLDRRTLEHITQMTHPFGLTIFGGYAYFSDWRLGGIVRVRKSDGGEMTIIRRGISNIM
HVKAYDAHSQIGSNYCNRGTNPNGDCSHFCFPVPNFQRVCGCPYGMKLAPNQLTCVEDPS
NEPPTLQCGSYSFSCGNGRCVPQYYQCDGVDDCHDNSDEQNCGSSNNTCASSAFTCASGQ
CIPGRWHCDKHNDCFDGSDELHCPTQEPSSCPGTQFTCDNKRCIPRIWLCDTDNDCGDGS
DEKNCTFAGTCEPRQFQCPDHRCIDPYYVCDGDKDCIDGADEHDCIYNCSATEFKCLSGD
QCISTYYQCDGVFDCNDHSDETNCPTRPPGMCHQHEFQCQSDGNCIPDNWECDGHLDCAD
GSDEHHRCPTRTCPPSLFRCDNGNCVYRAWICDGDNDCRDMSDERDCPTQPFRCPSWQWQ
CPGHSICVNLSKVCDNSADCPNGADESPLCNQESCSDNNAGCTHECIQGPFGAQCTCPIG
YQLANDSKTCEDIDECDPPGFCSQHCYNERGSFRCYCDEGYILETNGRTCKAAESGNLLL
LVASRNQIVVDNITSQSHSIYSLVRDGTNIVAIDFDSITDRIFWSDTTQDKIWSAYQNGT
DRKIVFDSGVTVTESIAVDWIGRNLYWTDFVLETIEVSKVDGSHRTVLLSENITNPRGLV
LDPRTDAHVMFWTDWGQNPRIERASMDGKMRTVIINNKIYWPNGLAIDYPNRLLYFADAY
LDYIDFCDYNGNNRRQVVASDLILQHPHALTVFEDFVYWSDRYTNRVIRANKWHGGNQTV
MIYNIHQPLGLVAVHPVKQPNGINSCASSPCSHLCLLSSSGPLFFSCACPSGWILSPDNR
NCMRVEHPFLIAVRDNIIYGISMNPEEKTNDAMVPIAGVQNGVDVDFDDSEQMIYWVENP
GEIHRVRSDGTNRSVFAPAAVIGSPIGLALDWISANLYYTNPGTQSIEVLKLHGDIMYRK
TLITNDGTPLGAGTPIGLAVDPARGKLYWTDQGTDSGVPAKIASANMDGSGIQTLFTGNL
DHVEFLTIDIKEQKLYWAVTSTGVIERGNVDGTNRVTLVVHLSHPWGIAVYDTFLYYTDR
DYEVIERVDKSTGANKVVLRDNVPRLKGLRVYYRDNSAGSSNGCSNNIGVCQQLCLPVPH
GLFSCACATGFQLNPDNRTCSPYSSFVIVSMLSAIKGFSLETSDHSEAMVPLAGRGRNAL
HVDVHMPSGFIYWCDFSSTVSSQNAIRKIKPDGSYFRNVVTNGIGRNGIRGIAIDWVAGN
LYFTNAFLTETFIEVLRLNTTYRRVLLKTTIDMPRHIVVDPKNRYLFWADYGQNPKIERA
FLDCTNRTVLVSEGIVTPRGLAIDHSNGYVYWVDDSLDMIARIQPDGGDVEIVRYGSRYP
TPYGITIFGNSMIWVDRNLKKVFQASKEPGNTDQPTVIRDNINWLRDVTIYNSNFQSRSP
FDVNNNPCLDSNGGCSQLCFALPDVQTPKCGCAFGTLNSDGKRCFISNDDYLIFALENAL
RSIHLDPENHSPPFRTINVLRTAVALDFDSINNRIYFTQSFPSGTGRISYVSIYSGIGSP
TVVASDLGTPDGIAFDWINNRVYYSDYLNQTISSMAVDGSNHTVIARVPRPRAVVLDPCR
GYMYWTDWSSNAKIERATLGGNFRTPIVSTNLVWPNGLTLDYEEQQLYWADANLQKIERC
TLTGTNREVIVSTALHPFAMTLFDQHIYWTDWNTRSIYRANKYDGSDQIVMIMNLPQRPM
DIHVWAKSKQQQCTNPCNQFNGGCSHICAPGPAGAECQCPSEGRWYLANNNKHCIVDNGT
RCDPGFFTCLNGQCISERWKCDNDYDCVDGSDELESVCAFHTCQPTAFTCGNGRCVPYHY
RCDHYNDCGDNSDELGCLFRTCDSNTEFTCNNGRCIALQYVCNGVNNCYDNGTSDERNCP
ERTCQSGFTKCQSTNICIPRTYLCDGDNDCGDMSDESPTHCVSLTCTNNEFRCTSGRCIP
AHWYCDQGIDCADGSDEPASCVPQLRTCSSDQFRCDDGRCIPATWICDGDNDCGDMSDED
QRHNCANRNCTAAEFTCVNNRPPLRRCIPRAWVCDGDADCSDAFDEHQNCTRRSCTENEF
TCSNGLCIRNTYRCDRRNDCGDSSDERGCIYEPCQQHQFTCQNGRCISKAYLCDGDNDCG
DESDELEHLCNTPEATCSPHHFKCDNGNCIEMVKVCNRLDDCLDNSDEKGCGINECSDPS
ISGCDHDCTDTQTSFYCSCHPGYKLMSDKRTCDDIDECNETPSVCSQICENTAGSYICKC
APGYIREPDGKSCRQNSNISPYLIFSNRYYLRNLTADGQSYSLILQGLRNVVALDFDRVE
KRLYWIDVGRNVIERMFLNGTNKEAVISDDVPNGEGIAVDWVGRKLYWVDAYKDCLYVSE
LDGRFRKKLVDRCVDANNTFCFQYPRGIVVHPKYGQIFWTDWADRAYIGRAGMDGKEKTV
IISTKLEWPNGLTIDYTNDKLYWTDAHLNYIEYSDLDGHHRHTVYDGTLPHPFAVTVFED
TIYWTDWNTRTVEKGNKYDGSDRTVLVNTTHRPFDIHVYHPYRQPFVNNPCGTNNGGCSH
LCLIKAGGQGYSCECPDNFMIIQFGDTAHCLPMCSSTQFLCADTERCIPIWWKCDGQRDC
RDGSDEPPTCPHRYCPVGQFQCNDGNCTSPHFLCNIQPDCRDGSDEDPVLCANHQCETHQ
WQCANKRCIPEAWQCDREDDCGDNSDEDSAHCASRTCPPGQFKCDNGRCIPLSWKCDVDD
DCGDNSDEPFHECMGPAYRCDNHTQFSCRSNYRCIPLWAVCNGNDDCRDNSDEQGCEEMT
CNPVGDFRCDNHRCIPLRWKCDGDNDCGDNSDEHNCSPRECTESEYRCDNLRCIPSRWIC
DHDDDCEDNSDERDCELRTCHPGYFQCDSGHCVAERFRCDGNADCLDFSDEATCPTRYPN
GTYCPPMLFECKNHVCIQPYWKCDGDNDCGDDSDEELHLCLDIACESPFRFRCENNRCIY
SHELCNQEDDCGDGSDEKEEHCREPTPRPCTTEEFKCSNGNCIPLHYVCDNYDDCGDHFD
ETGCNPGTERTCAENICEHNCTNLNEGGFICSCRPGYKASETNRNSCDDINECEIFGTCT
QDCRNSKGSYECFCADGFRSVGDQQGKQCAANGNPPLLLLPDNVRIRRYNISSEQYSDYI
DNQERIQALDYDWDPEGIGLSIVYFSVLGQGSEFGAIKRAYLPTFDSSRNNPTKEVDLNL
KYIVSPDGLAVDWVGRHLYWTDAGTNRIEVAKLDGRYRKWLIFTLLDQPAAIAVNPKRGL
MYWTDWGRQPKIECAWMDGQQRQTLVSEDLGWPTGLSIDYLNNDRIYWSDSKENIIESMR
PDGTDRTIVLHGEVGSPYSLDVFEGHLYWIAKERGEVWKKDKFGNGEKVKVLTVNPWLTQ
VRIYHQHRYNQSVPNPCKDVCSHLCLLRPGGYSCSCPQGTRFVEGSSTECDAAIESPPTM
PPACRCMNGGTCYIDESSLPKCKCSYGYTGNYCEIGLSKGVPPGTTAVAVLLTVILIIII
GVLVVGGFFNYRRTGSLLPVLPKLPSLSSLVKSNENGNGVTFRSGADVSMDIGVSGFGGD
SAIDRAMQMNENFAVESGKQPITFENPMYTTRDGGASTAGAVTVVRPTLVAAAGSEENEN
FENPVYASVISTSPKETPQSTDAPQESKWRFFKRKMKQNTNFENPIYAEMEKERQQDTEN
VPSPSPSLPPKIILKRDQPLAYTATEDTFKDTANLVKEDSVV
NT seq 13989 nt   +upstreamnt  +downstreamnt
atgggacctcgccatcggatggatggaagagcagcaactgcttgcaaactgctcatactg
ttcactgcatgcataatgcggggcagttgccaaggctgtgagcggggacagtttcgctgt
gggaatggtcgctgtatccctgcagattggaggtgtgatggggccagagactgctcagat
gacacagatgaagctggctgcccccaacctacctgtgagggaaatcagtttcagtgtcag
actgacggtgaatgtattccacagtcatgggtttgtgatgatgaggaagattgtgaagat
ggctcagatgagcatcaacaatgtccgggaaggacgtgctcaagtgagcagttcacgtgc
tcaaacggacagtgtatccccagcacatactggtgcgatcgagtagaggactgcactgat
ggaacagatgaaagagcctgccactacccaagatgtgaacagttatcgtgtgcaaacgga
gcatgttttaatgcaagccagcgatgcgatggcaaagttgattgccgagattcttctgat
gaagctaattgcacacgtggctgtaccagcacgcagtttcagtgtgctaacggagaatgc
atccctcgagccttcctctgtgaccatgatgatgactgtggagacaggagtgatgaaaac
tcttgcacttatgcaacttgcagaggcaactttttcacttgcccgagcggccgctgcatt
catcagagctggatatgtgatggagatgacgactgtgaagataatgaagatgaaagagga
tgtgaaagtggtcgccaggagtgctacccaggagagtgggcctgccctgggtcagggcat
tgcattccaattggaaaagtgtgtgatgggactgcagactgccctgaaggagaagatgaa
actaacatcactgcaggcagacattgcaacatctcccgctgcgctgctctgagttgccag
tatcgctgtcactcttctccctcaggagggatgtgttattgccctgcaggatataccata
agtggcaatgacagtcgcacttgtattgattttgatgactgtaaaatgtggggtgtctgt
gaccagctgtgtgaagatcgtgtgggacatcaccagtgtcactgtgtggaaggttatttc
ctagagcatcatcggcattgtcgggccaacacttcagctggtgttgcgtccattattttt
tccaatggccgtgatttactgattggagatcttcatggaagaaatttccgtactttggtg
cagtcacggaaccgtggggttgcagttggagtggactttcacttttacctgcgcagaatc
ttttggactgatacggtgcaagataaggttttttctattaatattgatggctctgattta
caagaagtattaaatatttcggttgacacacctgaaaacctagcagtggactgggttaac
aataaactatacgtggttgagaccagtgtgaacagaatagatatggttaacttggatgga
acaaaccgtgtgactcttattgctgaaaatcttggaaatccgagaggaatagcacttgat
ccaactgttggttacctgtttttctcagactgggacagtctttctggtgatcctaaagtg
gagagggccttcatggatggcacaaatcgtcaggatctgataaaaacaaaattaggctgg
cctgctggaataaccttggatattgtgtcaaagagactttactgggttgacagccggttt
gattacattgagactgtaacttatgatggacttcaaaggagaacagtagctcatggaggc
tcactgattcctcatccgtatggaatcactttatttgaacacaacgtttatttcactgat
tggaccaaaatggcagtggtgaaagctaacaaattttcggaatctaaccctcaagtgatc
taccagtcttccctgagaccttatggagtgacagtttaccatgctgccaggcagccatat
gcaagaaatccctgtggaagtaataatgggggatgtgaacaggtctgcgttctcagccac
aaaacagataatgatggactaggttatcgctgtaggtgtattctgggctttgatctgcat
gtagatggacgacactgtgttgctgtgcggcagtttctgctgttttcatcccagatggca
gtgcgggggatcccgttcaatctctcctctcaggaagacgtgatcatacctgtaaccggg
agcccttcatactttgttggaattgacttctgtgctcaggatgacaccatttttttttca
gatacaagtaaagacgtgatctataaacagaaaactgatggttcaggaagagagatctta
actgctaatagagtggaaagtgttgaagatttggcctttgactggatctctaagaatcta
tactggacagatcctcggtacaggagcattagtgttatgaggctggcagataaatctagg
agagctattgttcagaatttaaataatcctcgatcaatagtggttcatcctgttgttggg
tatatattctggacagattggttccgtcctgcaaaaatcatgagggcctggagtgatgga
tcccatgccttgccaattgtgaatacaacgctaggctggcctaacggcctggccattgac
tggagctctctaaggctgtactgggtggatgctttttttgataaaattgagcacagcacc
tttgatgggctggacagaaggactcttgaacatattactcagatgactcacccatttggt
cttactatttttggaggttatgcctatttcagtgattggagacttggtggaatagttcga
gtgaggaagtcggatggaggtgaaatgactattattaggaggggcattagtaacatcatg
cacgttaaagcctatgatgctcattcccaaataggctctaactactgtaacagaggaaca
aatcccaatggagactgcagccatttctgcttcccagtaccaaattttcagagagtttgt
ggttgtccctatggcatgaagctggctccaaatcagctgacatgtgttgaagatccatcc
aatgagccacccactttgcagtgtggctcttactcattttcctgtggtaatggaagatgt
gtgccccagtactatcagtgtgatggtgttgatgactgccatgataacagtgatgaacaa
aactgtggttcttcaaacaatacttgtgcttcatcagcttttacctgtgccagtggacag
tgtattccaggtcgctggcattgcgataaacataatgactgtttcgatggcagtgatgaa
ttgcactgtcctacacaagaaccctcttcatgccctggaacacagttcacctgtgataat
aaaagatgtattccaagaatctggctttgtgatactgataatgactgtggtgatggttca
gatgaaaaaaactgcacttttgcaggtacttgtgaacccaggcaatttcagtgtccagac
catcgctgcattgacccatactatgtctgtgatggagacaaagattgtatagatggtgct
gatgagcatgactgcatatataactgcagtgccacagaatttaaatgtctaagtggagac
caatgtatcagcacttactaccagtgtgatggtgtttttgactgtaatgatcactcagat
gagactaattgccctacaagaccaccagggatgtgccaccagcatgaattccaatgccag
tcagatggcaattgcattcctgataactgggaatgtgatggccatcttgactgtgcagac
ggctcagatgaacaccacagatgtcctaccagaacatgtcctccatctcttttccgctgt
gataatggcaactgtgtctatcgggcgtggatctgtgatggtgataatgactgcagggat
atgagtgatgagagagattgtcctactcagcctttccggtgccccagctggcagtggcaa
tgtccaggtcacagtatctgtgtgaacctgagcaaagtatgtgataattctgctgattgt
ccaaatggagctgatgaatccccactgtgcaatcaggagagctgctctgacaataatgct
ggctgcactcatgaatgtattcaaggaccctttggagctcagtgtacctgtcctattgga
taccagcttgcaaatgactccaagacctgtgaagatattgatgaatgtgaccctccaggc
ttttgtagtcaacactgttacaatgagagaggatcttttaggtgttactgtgatgaagga
tacattttagaaaccaatgggaggacttgtaaagcagcagagtcggggaatcttcttttg
ctggtggcaagtcgtaaccaaatcgttgtggataacatcacttctcagtcacacagcatt
tattctctggttcgggatgggaccaatattgtggctattgattttgattcaatcacagat
cgtattttttggtctgatacaacacaggataaaatttggagtgcttatcaaaatgggact
gacagaaaaatagtgtttgacagtggtgtcaccgtgaccgaaagtatagcagtagattgg
ataggtcgtaacctttactggacagactttgttctggaaacaattgaagtctctaaagtg
gatgggagccacaggactgtgctgctcagtgaaaatataaccaacccaaggggactagtg
ttagatcccagaactgatgctcatgtaatgttctggactgactggggccaaaaccctcgg
attgaaagagccagcatggatggcaaaatgcgcacagtgattattaataataaaatctat
tggcccaatggacttgccattgattacccaaacagacttctctattttgctgatgcttat
cttgattacattgatttttgtgattacaacggaaacaacagacgacaggtggttgcaagc
gatctgatattacaacatccacatgctctaactgtctttgaagactttgtgtactggagt
gaccgctatactaatcgagtaattcgagccaataaatggcatggaggaaaccagacagtt
atgatttataacattcaccagcctttggggcttgtggcagtccatcctgtaaagcagcct
aatggtattaattcctgtgcatcgtccccctgtagccacctctgcttgctttcttcatcc
ggaccgctttttttttcctgtgcttgcccttcaggatggatcctttctcctgataacagg
aactgcatgagagttgaacaccctttccttattgctgtaagagataatataatttacgga
atttctatgaaccctgaggagaagacaaatgatgctatggttccaatagcaggagttcaa
aatggtgtcgatgttgactttgatgactctgaacagatgatttattgggttgaaaatccg
ggtgaaattcacagagtgaggtcagatggaaccaacaggtcagtttttgctccggcagct
gttattggttctcctattggtctggcattggactggatatctgcaaacctgtattacact
aacccagggacacaatcaattgaggtcctgaagctgcatggtgacataatgtacaggaaa
acactgattaccaatgatggcacccctctgggagctggcacaccaattggtttggcagtt
gatccagcaagagggaagctgtactggacagaccaaggaactgacagtggagtcccagca
aagattgccagtgcaaacatggatggatcaggcatacaaacgctattcactggcaacctt
gaccatgtagagttccttaccattgacattaaggaacaaaagttgtactgggctgtcacg
agcacaggagtgattgagagaggcaatgtggatggtacaaaccgtgtgaccctggtggtt
catctttctcatccgtggggaattgctgtgtatgatacgtttctgtactatactgatcga
gattatgaagttatcgaacgagttgacaaatccactggtgcaaacaaagtagtactgaga
gataatgtcccaagactaaagggcctacgtgtgtattacagagacaattctgctggttcc
tcaaatggctgcagtaataatattggagtttgccagcagctttgcttgcctgtacctcat
ggattattttcctgtgcctgtgctaccggctttcagctaaatcctgataacagaacctgt
tccccatacagttcatttgtaattgtatctatgctttctgcaattaaaggatttagttta
gagacatcagatcactctgaagccatggtaccactggcaggaagaggacgaaatgcgctt
catgtggatgttcacatgccttctggtttcatttactggtgtgacttcagtagcacagtt
tcttctcagaatgcaatacgtaaaattaaaccggatggttcttactttagaaatgttgtt
acaaatggaataggacgaaatgggatccgtggcattgcaattgactgggtagcaggaaat
ctttattttacaaacgcattcctgacggagacttttatcgaagttttgcgcttaaacaca
acttatcgtcgtgtgctgcttaaaactactatagatatgccaaggcacatagtggttgac
ccaaaaaacagatatctgttctgggcagactatgggcaaaatccaaagatcgaacgtgca
tttcttgactgcaccaacagaacagttcttgtgtctgagggcattgtcacacctcgcggg
ttggccatagatcacagcaatggctatgtttactgggtggatgattccctagatatgatt
gcaagaattcagcctgatggtggtgatgttgaaattgttcgctatggcagccgctatcca
actccatatggtatcactatctttggcaattctatgatctgggtggatcgaaacctgaaa
aaagtcttccaagccagcaaggaaccaggcaatactgatcagccaacagtaataagagat
aacattaattggctaagggatgttacaatttacaacagtaatttccagtcacgttcaccc
tttgatgtcaacaacaatccttgtttggacagcaacggaggttgttctcagctctgtttt
gccctccctgatgtgcagacacctaaatgtggttgtgcctttggaacactaaacagtgat
ggcaagagatgtttcatttcaaatgatgattacctgatttttgctcttgagaatgccctc
agaagcatccacctagatcccgaaaatcacagtcctcccttccgcacaatcaatgtgtta
agaactgctgtggccctggattttgacagcataaacaaccgaatttattttacacaaagt
tttccttcagggacaggaagaatcagttatgttagtatttactcaggaattggctctcca
acagtagttgcatctgacctggggactccagatggcatagcctttgactggatcaacaac
agagtttattacagtgactacctcaatcagacaatcagctccatggctgtggacggatcg
aatcacacagtgattgcgcgggtgccacgacccagagctgttgtattagatccctgcaga
gggtatatgtactggactgactggagttcaaatgcaaagatagagcgagctacacttgga
ggaaacttcagaacacctattgtaagcaccaatttggtatggccgaacgggcttaccttg
gattatgaagaacagcagctatactgggctgatgcaaatctgcagaagattgagaggtgc
actctcactggtacaaatcgtgaggtaattgttagcactgctctgcatccatttgcaatg
acattgtttgatcagcacatatattggacagactggaacacacgaagcatttatcgagct
aataagtacgatggttcagatcagattgtaatgatcatgaatcttccacaaagaccgatg
gatattcatgtctgggcaaaaagtaagcagcagcagtgtaccaacccttgcaaccagttc
aatggtggctgcagtcacatctgtgcaccaggtccagctggtgcagaatgtcagtgcccc
tctgaaggtcgctggtatttagccaataacaacaagcattgtattgtggataatggtacc
aggtgtgatcctggtttcttcacatgcctcaatgggcagtgcatctcagagcgatggaaa
tgcgacaatgactatgactgtgttgatggcagtgatgagttggaaagtgtgtgtgctttc
catacctgtcagccgacagcgtttacctgtggcaatgggcgatgtgttccctaccactac
cgctgcgatcactacaacgactgtggagataacagtgacgagcttggctgcttgttccga
acctgtgactccaacacagagtttacttgcaataatggaaggtgcatagctcttcagtat
gtctgcaatggagtaaacaactgttacgataatggcacatcagatgagagaaattgcccg
gaacgtacttgccagtctggttttacaaaatgccaaagcacaaatatttgcattcctcga
acatatttgtgtgatggtgataatgactgtggagatatgagtgatgagagccctactcac
tgtgtctcactgacttgcacaaataatgagtttcgctgtacatcggggcgttgtattcct
gctcattggtactgtgatcaaggaatagactgtgctgatggctctgatgaacctgcctct
tgtgtgccccagttgcggacttgttcaagcgaccagttcagatgtgatgatggcagatgt
atcccagcaacttggatctgtgatggtgataatgactgtggggatatgagtgatgaggat
caaagacataactgtgcaaaccgcaactgcacagcagcagagttcacgtgtgtcaacaat
cgacccccactcaggaggtgcatccctcgggcttgggtctgtgatggtgatgctgactgc
agtgatgcttttgatgaacaccagaactgcacacgaagatcttgcacagaaaatgagttc
acctgtagtaatggcttgtgcatccgtaatacatacagatgtgataggcgaaatgactgt
ggtgacagcagtgatgaaaggggatgcatctatgaaccatgtcaacagcaccagttcact
tgtcagaatgggcgctgcatttccaaagcctacctctgtgatggggataatgactgtggt
gatgaatctgatgagctggaacatctctgtaatacaccggaagcgacctgctctccccat
cattttaaatgtgacaatggaaactgcattgaaatggtcaaagtctgcaatcggttggat
gattgcttagataacagcgatgaaaaaggatgtggtataaatgaatgcagcgacccttca
atcagtggatgtgatcatgactgtacagacacacagacaagtttctactgttcttgtcat
cctggatacaaacttatgtctgataaacggacttgtgatgatattgatgagtgcaatgaa
actccatcagtatgtagccagatttgtgagaacacagctggctcctacatctgtaagtgt
gccccaggctatatccgggagcctgatggaaaaagttgccggcaaaatagtaatatctcc
ccataccttatttttagcaaccgttactatctgagaaatctcacagcagatggccagtct
tactctctcattttgcaaggactgagaaatgtggtggcactggactttgacagggtggaa
aagaggttatactggattgatgtggggaggaatgtcattgaacgaatgttcctaaatgga
acaaataaggaggcagtgataagtgatgatgtgcccaacggggaaggtatcgctgttgac
tgggttggcagaaaattatactgggtggatgcctacaaagattgtctctatgtctctgaa
cttgatggaagattccggaaaaaactggtggatcggtgtgtggatgccaacaacactttc
tgctttcagtatcccagaggaattgttgttcatccaaaatatggacagattttctggaca
gactgggcagatcgagcctatattggacgagcaggcatggatggcaaggaaaagactgtg
attatctctacaaagttagagtggcccaatggacttaccatagactacaccaatgacaag
ctctactggacagatgctcatctaaattacattgagtactctgatctggatggacatcat
cgtcacacagtgtatgacgggactttacctcatccatttgcagtaacagtttttgaagac
acaatatattggactgactggaacacaaggacagttgaaaagggaaataaatatgacgga
tcagacaggactgttcttgtgaacaccacacacaggccgtttgacatccatgtttatcat
ccatatagacaaccatttgttaataatccatgtggcacaaataatggtggctgttctcat
ctttgtctaataaaagccggtggtcagggttattcctgtgagtgtcctgataacttcatg
ataatacagttcggtgacacagcccactgccttccaatgtgctccagcacccagtttctc
tgtgcagacactgagaggtgtattcctatctggtggaaatgtgacggacagagggactgt
cgggatggctctgatgagcccccaacctgtccacaccgctactgtcctgtcgggcagttc
cagtgtaatgatgggaactgcacaagcccacatttcttgtgcaatatccagccagattgc
cgtgatggatcagatgaagatcctgtactttgtgctaatcaccagtgtgaaactcatcag
tggcagtgtgccaataaacgatgtatcccagaagcctggcaatgtgatagagaggatgac
tgtggtgacaactcggatgaagatagtgctcactgcgccagtagaacctgtcccccgggc
caatttaaatgtgacaatggccgctgcatcccactgtcctggaagtgtgatgtggatgat
gattgtggtgataactctgatgagccgttccacgaatgcatgggacctgcctatcgatgt
gacaatcacacacagttcagctgtagaagcaactaccgttgcataccattgtgggcagtg
tgcaatgggaatgatgactgcagagacaacagtgatgaacaaggctgtgaggagatgact
tgcaatcccgttggagatttccgttgtgacaatcatcgatgtattccactgcgctggaag
tgtgatggagataatgactgtggagataactctgatgagcacaactgcagtcctcgcgaa
tgcacagaaagtgaataccggtgtgacaatctgcgctgcatcccttcccggtggatctgt
gaccacgatgatgactgtgaagacaattcagatgaacgtgactgtgagctgaggacctgc
catccaggttatttccagtgtgatagtggacactgtgttgcagaacgcttcagatgtgat
ggaaatgcagactgccttgatttctctgatgaagcaacttgtccaacacggtatcctaat
ggtacgtactgtccgcccatgctgtttgaatgtaagaaccacgtctgtatccagccatac
tggaaatgtgatggtgataatgactgtggagatgactctgatgaagaacttcacctttgc
ttggatattgcttgtgaatctccattccgcttccgatgtgaaaacaatcgctgtatatac
agtcatgagctgtgcaaccaggaggatgactgtggagatggaagtgacgagaaagaggaa
cactgtagagaaccgacaccaagaccatgtacaactgaagaattcaagtgcagtaatggg
aattgcattcctctgcattatgtctgtgacaattatgatgactgtggagaccattttgat
gaaacgggctgcaatcctggaacagagcgaacttgtgcagaaaatatctgtgaacataac
tgtaccaacctgaatgaaggaggctttatctgttcctgtaggccagggtacaaggccagt
gaaactaaccgaaactcctgtgatgatatcaatgagtgtgagatctttggaacatgcacc
caggactgcaggaattccaaaggaagctacgaatgtttctgtgcagatggcttcaggtct
gtgggtgatcaacaagggaagcaatgcgcagctaatggtaatcctccattgttactgctg
ccagataacgtgcggattcgaaggtacaacatctcatcagagcagtactctgactatatc
gataatcaggagcgcatccaagctctggattatgactgggaccctgaagggataggcctg
agtatcgtgtacttcagtgttctgggacagggttctgagtttggagccatcaaacgtgct
tatctgcccacatttgacagcagtaggaacaatcctacaaaggaagttgacttgaatctc
aaatacatagttagtcctgatgggttggctgttgactgggttggaagacatctttactgg
actgatgcagggactaatcgcatagaggtggcaaaattagatggacggtacagaaaatgg
cttatttttactctactggatcaaccagcagctattgctgtcaatccaaaacgtgggctc
atgtattggactgactggggaaggcagccgaagattgaatgtgcctggatggatggacaa
caaagacaaaccctggtctctgaagaccttggctggccaacaggtctttctattgattat
ttgaacaatgataggatctactggagtgattctaaagaaaatattattgaatccatgagg
cctgatgggacagacagaaccattgtattacatggagaagtaggcagtccatacagcctt
gatgtctttgaaggccatttatattggatagctaaagaacgaggagaagtctggaagaaa
gataaatttggaaatggagaaaaagtgaaagtgctgactgtgaatccgtggcttactcaa
gtgcgcatctatcaccagcacagatacaaccagtcagtgcctaatccttgtaaagacgtc
tgcagccacctctgcttgctgagaccaggagggtacagctgctcgtgtcctcagggaact
cggtttgtagaaggcagcagcacagagtgtgatgcagctattgaatcccctcccacgatg
ccaccagcttgcaggtgcatgaatggaggaacctgctatatagatgaaagcagtctccca
aaatgcaaatgttcttatggatacactgggaattactgtgaaataggactgtcaaaagga
gtccctcctggaacaacagcagtagcagtgttgctgacagtcatactgatcataataatt
ggagtattggtggttggaggcttttttaactacagacgaacaggctcccttttaccagtg
cttccaaaactaccaagtttaagcagtcttgtaaaatctaatgaaaatggcaacggggta
actttccgatctggagcagatgtgagtatggacataggagtctctggctttgggggagat
tctgctatagacagagcaatgcaaatgaatgaaaactttgcggtggagtcagggaagcag
ccgatcacatttgaaaatccaatgtacacaaccagagatggtggagccagcacagctggt
gcagttacagtcgttcggccaacacttgtagcagcagctggtagtgaggaaaatgaaaat
tttgaaaatcctgtgtatgcctctgtgatatctactagtccaaaggaaacccctcagagt
acagatgcacctcaggaatcaaagtggcgcttcttcaagagaaaaatgaaacaaaacact
aattttgaaaacccaatatatgcagagatggaaaaggaacggcaacaggacacagaaaat
gtccctagcccttctccttcactgcctcccaagattattctgaagagagaccaaccacta
gcttacacagcaacagaggatacatttaaagacaccgccaatcttgttaaagaggactct
gtggtataa

DBGET integrated database retrieval system