KEGG   Empidonax traillii (willow flycatcher): 114056148
Entry
114056148         CDS       T05887                                 

Gene name
IGF1
Definition
(RefSeq) insulin-like growth factor I isoform X1
  KO
K05459  insulin-like growth factor 1
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04010  MAPK signaling pathway
etl04068  FoxO signaling pathway
etl04114  Oocyte meiosis
etl04115  p53 signaling pathway
etl04150  mTOR signaling pathway
etl04510  Focal adhesion
etl04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114056148 (IGF1)
   04068 FoxO signaling pathway
    114056148 (IGF1)
   04150 mTOR signaling pathway
    114056148 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    114056148 (IGF1)
   04115 p53 signaling pathway
    114056148 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114056148 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    114056148 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:etl04052]
    114056148 (IGF1)
Cytokines and growth factors [BR:etl04052]
 Growth factors
  Growth factors (RTK binding)
   114056148 (IGF1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 114056148
NCBI-ProteinID: XP_027736928
LinkDB
Position
Unknown
AA seq 153 aa
MEKINSLSTQLVKCCLCDFLKVKMHTVSYTHFFYLGLCLLTLTSSVAAGPETLCGAELVD
ALQFVCGDRGFYFSKPTGYGSSSRRLHHKGIVDECCFQSCDLRRLEMYCAPIKPPKSARS
VRAQRHTDMPKAQKEVHLKNTSRGNTGNRNYRM
NT seq 462 nt   +upstreamnt  +downstreamnt
atggaaaaaatcaacagtctttcaacacaattagttaagtgctgcttgtgtgatttcttg
aaggtgaagatgcacactgtgtcctacacccatttcttctaccttgggctgtgtttgctt
accttaaccagttctgttgctgctggcccagagacactctgtggtgctgagctggttgat
gctcttcagttcgtgtgtggagacagaggcttttacttcagtaagcctacagggtatgga
tccagcagtagacgcttacaccacaagggaatagtggatgaatgctgcttccagagttgt
gacctgaggaggctggagatgtattgtgctccaataaagccacccaagtctgcacggtct
gtacgtgctcagcgccacactgatatgccaaaagcacaaaaggaagtgcatttgaagaat
acaagtagagggaacacaggaaacagaaactacagaatgtaa

DBGET integrated database retrieval system