KEGG   Empidonax traillii (willow flycatcher): 114057009
Entry
114057009         CDS       T05887                                 

Gene name
MGRN1
Definition
(RefSeq) E3 ubiquitin-protein ligase MGRN1 isoform X1
  KO
K10604  E3 ubiquitin-protein ligase MGRN1 [EC:2.3.2.27]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04120  Ubiquitin mediated proteolysis
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    114057009 (MGRN1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114057009 (MGRN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:etl04121]
    114057009 (MGRN1)
Enzymes [BR:etl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     114057009 (MGRN1)
Ubiquitin system [BR:etl04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    114057009 (MGRN1)
SSDB
Motif
Pfam: zf-C3HC4_3 Prok-RING_4 zf-RING_2 zf-RING_5 zf-C3HC4_2 zf-RING_11
Other DBs
NCBI-GeneID: 114057009
NCBI-ProteinID: XP_027738552
LinkDB
Position
Unknown
AA seq 561 aa
MGSLLSRRIAGVEDIDIQANSAYRYPPKSGNYFASHFFMGGEKFDTPHPEGYLFGENMDL
NFLGNRPVQFPYVTPAPHEPVKTLRSLVNIRKDSLRLVRYKDDVDSPMEENGKQKVLYSL
EFTFDADARVAITIYCQATEEFVGGMAVYSTKNPSLQSETVHYKRGVSQQFSLPSFKIDF
SEWKDDELNFDLDRGVFPVVIRAVVDEGDVVVEVTGHAHVLLAAFEKHVDGSFSVKPLKQ
KQIVDRVSYLLQEIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLC
NSCADTLRYQANNCPICRLPFRALLQIRAVRKKPGALSPVSFSPVLAQSVDHDEHSSSDN
IPPGYEPISLLEALNGLRSVSPSIPSAPLYDEISYSGVVDGIPPTSRPLVAMDRALESGH
QKGKRSKSPDSTLRSPSSPIHEEDEEKLSEDSDSQPALSGGELVLRETSSPESVAGEEME
EASPVQQGGGRPPSVEDVLQDGGCGESRSLTRSESDPPVDVFLPGSSDYTKTLPVRGTGS
PVQPLLFEQTRLHLEDEQSLP
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgggctccctgctcagccgccgcatcgcgggcgtggaggacatcgacatccaggccaac
tcggcctatcgctacccgcccaagtccggaaactactttgcaagtcacttctttatggga
ggggagaagtttgacacccctcaccccgagggctacctttttggggagaacatggatctg
aacttcctcgggaatagacctgttcagtttccctacgtaactccagctccacacgagcca
gtgaagacgctgaggagtttggtgaatatccgcaaagactctctccggcttgtgaggtat
aaagatgatgttgacagtcctatggaggagaatgggaagcagaaggtgctgtacagcctg
gagttcaccttcgacgcagatgcccgtgttgccatcacaatctactgccaggccacggag
gagtttgttgggggcatggcagtatacagcacaaagaatccctctctgcagtcggagacg
gttcattacaagagaggggtaagccagcaattctccctgccttccttcaagattgacttc
tcagagtggaaggatgatgagctgaactttgacctggatcgtggggtgttccctgtggtc
atccgagcagtggtggatgaaggggatgtggtagttgaggtcactggtcacgcccatgtt
ctcctggctgcgtttgaaaagcacgtcgacggcagcttttctgtgaagcccttaaaacag
aagcagatcgttgaccgggtgagctacctgctccaggagatctacggcatcgagaacaaa
aacaaccaggagaccaagccctcagacgacgagaacagcgacaacagcaacgagtgtgtg
gtttgcctgtcggacctgcgggacaccctcatcctgccctgcagacacctctgcctgtgc
aactcctgtgctgacaccctgcgctaccaggccaacaactgccccatctgcaggctcccc
ttccgtgccctgctgcagatccgggcggtgaggaagaagccgggggctctgtcgccggtg
tcgttcagccccgtcttggcacagagcgttgaccatgacgagcactctagctctgacaac
atccctccaggctacgagcccatttccttgctggaggcgctgaacgggctccgctccgtt
tccccctccatcccctctgctcctctgtacgatgaaatcagctactccggggtggtggat
gggatccctcccaccagccgcccgctcgtggccatggacagagccctggagagcggccac
cagaagggcaagcgcagcaagtctccagacagcacactacggtccccctcgtccccgatc
cacgaggaggatgaggagaagctctccgaggactccgactcgcagccggcgctgagcggg
ggtgagctggtcctgagggagaccagctctccagagagcgtggcaggggaagagatggag
gaggcctcgcctgtgcagcagggtggtggccgcccaccctcggtggaggacgtgctgcag
gacggcggctgcggcgagagccggagtctgacacggtccgagagcgaccccccggtggac
gtgttcctgccaggctcatccgactacaccaagacgctccccgtccgcggcaccggcagc
cccgtgcagccccttctcttcgagcagacccgtctgcacctggaggacgagcagagcctc
ccgtga

DBGET integrated database retrieval system